BLASTX nr result
ID: Gardenia21_contig00047317
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00047317 (335 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME47825.1| hypothetical protein DOTSEDRAFT_69679 [Dothistrom... 59 2e-06 >gb|EME47825.1| hypothetical protein DOTSEDRAFT_69679 [Dothistroma septosporum NZE10] Length = 866 Score = 58.5 bits (140), Expect = 2e-06 Identities = 21/40 (52%), Positives = 31/40 (77%) Frame = -3 Query: 123 DCDGQPTQGYIHHVKGPHSTDIANQLDPNISGSSGLAAGE 4 +CDG+P +GY+HH +GPHSTD AN+LDP++ G +G+ Sbjct: 328 NCDGRPAEGYVHHTQGPHSTDTANRLDPHVPGEFPTESGQ 367