BLASTX nr result
ID: Gardenia21_contig00047262
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00047262 (286 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP12119.1| unnamed protein product [Coffea canephora] 99 2e-18 >emb|CDP12119.1| unnamed protein product [Coffea canephora] Length = 371 Score = 98.6 bits (244), Expect = 2e-18 Identities = 49/73 (67%), Positives = 57/73 (78%) Frame = -2 Query: 285 RDCCGDEISVSENFSDYSLIPDDLRFEFEDPVPDFSDLFGDSSNMFGCTSNFDCGNDSMF 106 RD CG+E VSENFS YSLIP+DLRFEFEDPV DFSDLF D+SN+F NF D+ F Sbjct: 283 RDSCGEETCVSENFSHYSLIPEDLRFEFEDPVVDFSDLFEDNSNIFEYARNF----DNTF 338 Query: 105 VDSSPDIEFGSSM 67 VDSS ++EFGS+M Sbjct: 339 VDSSENVEFGSAM 351