BLASTX nr result
ID: Gardenia21_contig00047256
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00047256 (241 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP15122.1| unnamed protein product [Coffea canephora] 44 4e-07 emb|CDP07957.1| unnamed protein product [Coffea canephora] 42 6e-06 >emb|CDP15122.1| unnamed protein product [Coffea canephora] Length = 1299 Score = 44.3 bits (103), Expect(2) = 4e-07 Identities = 22/50 (44%), Positives = 33/50 (66%) Frame = -3 Query: 152 NIFFQMKRLVCETACVIYSSYDHTITEDITRKQNLAITDLLQQFKVIKLE 3 ++F Q+K ++ ACVI S D+ +TED R+ +L LL++FKVIK E Sbjct: 323 HLFLQIKHVMGRAACVIPSFIDNDVTEDTVRQLDLDARVLLEEFKVIKQE 372 Score = 36.2 bits (82), Expect(2) = 4e-07 Identities = 15/31 (48%), Positives = 22/31 (70%) Frame = -1 Query: 232 LHEELKVLRYFLMDPSAEKYTKNHLKVTYFF 140 L +E K+LR +LMD SA++YT H K+ + F Sbjct: 295 LEDEFKILRDYLMDTSAQEYTDTHPKLKHLF 325 >emb|CDP07957.1| unnamed protein product [Coffea canephora] Length = 1275 Score = 42.0 bits (97), Expect(2) = 6e-06 Identities = 22/59 (37%), Positives = 34/59 (57%), Gaps = 2/59 (3%) Frame = -3 Query: 173 YQESFE--SNIFFQMKRLVCETACVIYSSYDHTITEDITRKQNLAITDLLQQFKVIKLE 3 Y +S E +N+ +K L+ A IY+SYD IT+++ NL + DL Q+ + IK E Sbjct: 318 YNQSNEKANNVLLHIKDLLFHAAYAIYTSYDSDITKEMAEVLNLTVADLFQEIEDIKQE 376 Score = 34.7 bits (78), Expect(2) = 6e-06 Identities = 13/29 (44%), Positives = 24/29 (82%) Frame = -1 Query: 241 LEYLHEELKVLRYFLMDPSAEKYTKNHLK 155 +E LH+EL+++R +L+DPSA +Y +++ K Sbjct: 296 IEALHKELQIMRDYLLDPSASQYNQSNEK 324