BLASTX nr result
ID: Gardenia21_contig00047205
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00047205 (259 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP13455.1| unnamed protein product [Coffea canephora] 66 1e-08 >emb|CDP13455.1| unnamed protein product [Coffea canephora] Length = 71 Score = 65.9 bits (159), Expect = 1e-08 Identities = 38/61 (62%), Positives = 40/61 (65%), Gaps = 3/61 (4%) Frame = +3 Query: 15 YIYRT*QRHCFHACTYGISSFNLT---LYSLCYSFVCLSTNRLIQGKQLLLNPSMLLHKA 185 YIY C Y I +F LYSLC SFVCLST+RLIQGKQLLLNP MLLHKA Sbjct: 10 YIYTQNLTKALLPCMY-IGNFRFQHSLLYSLCCSFVCLSTDRLIQGKQLLLNPPMLLHKA 68 Query: 186 T 188 T Sbjct: 69 T 69