BLASTX nr result
ID: Gardenia21_contig00047197
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00047197 (316 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP13910.1| unnamed protein product [Coffea canephora] 72 2e-10 >emb|CDP13910.1| unnamed protein product [Coffea canephora] Length = 360 Score = 72.0 bits (175), Expect = 2e-10 Identities = 34/36 (94%), Positives = 34/36 (94%) Frame = -3 Query: 314 LLAPAQMHSFSDTLQQDPLGRFQGLDIGSRTSHAVK 207 LLAPAQMHSFSD LQQDPLGRFQGLDIGSRTSH VK Sbjct: 310 LLAPAQMHSFSDALQQDPLGRFQGLDIGSRTSHTVK 345