BLASTX nr result
ID: Gardenia21_contig00047176
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00047176 (373 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP10873.1| unnamed protein product [Coffea canephora] 67 5e-09 >emb|CDP10873.1| unnamed protein product [Coffea canephora] Length = 511 Score = 67.0 bits (162), Expect = 5e-09 Identities = 33/38 (86%), Positives = 33/38 (86%) Frame = -3 Query: 116 MSPAQLPLESDSKGIAGFTATNAPSRKVGKTFASTDGK 3 MSPAQLPLESDSKGIAG TATN SRK GKTFAS DGK Sbjct: 1 MSPAQLPLESDSKGIAGVTATNTSSRKAGKTFASPDGK 38