BLASTX nr result
ID: Gardenia21_contig00047160
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00047160 (401 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDO99747.1| unnamed protein product [Coffea canephora] 62 2e-07 ref|XP_009784518.1| PREDICTED: auxin response factor 16-like [Ni... 61 4e-07 ref|XP_009602628.1| PREDICTED: auxin response factor 16-like [Ni... 61 4e-07 >emb|CDO99747.1| unnamed protein product [Coffea canephora] Length = 668 Score = 61.6 bits (148), Expect = 2e-07 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = -3 Query: 84 MNSGNKPMNEVEKSLEPQLWHACAGGMV 1 MNSGN+PMNEVEKSL+PQLWHACAGGMV Sbjct: 1 MNSGNEPMNEVEKSLDPQLWHACAGGMV 28 >ref|XP_009784518.1| PREDICTED: auxin response factor 16-like [Nicotiana sylvestris] gi|698473706|ref|XP_009784519.1| PREDICTED: auxin response factor 16-like [Nicotiana sylvestris] Length = 696 Score = 60.8 bits (146), Expect = 4e-07 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = -3 Query: 96 MITVMNSGNKPMNEVEKSLEPQLWHACAGGMV 1 MI +MN NKPMNEVEK L+PQLWHACAGGMV Sbjct: 1 MINIMNPVNKPMNEVEKGLDPQLWHACAGGMV 32 >ref|XP_009602628.1| PREDICTED: auxin response factor 16-like [Nicotiana tomentosiformis] gi|697187183|ref|XP_009602629.1| PREDICTED: auxin response factor 16-like [Nicotiana tomentosiformis] Length = 696 Score = 60.8 bits (146), Expect = 4e-07 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = -3 Query: 96 MITVMNSGNKPMNEVEKSLEPQLWHACAGGMV 1 MI +MN NKPMNEVEK L+PQLWHACAGGMV Sbjct: 1 MINIMNPVNKPMNEVEKGLDPQLWHACAGGMV 32