BLASTX nr result
ID: Gardenia21_contig00046861
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00046861 (409 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP10084.1| unnamed protein product [Coffea canephora] 67 7e-09 emb|CDP10083.1| unnamed protein product [Coffea canephora] 66 1e-08 ref|XP_011075194.1| PREDICTED: zinc finger A20 and AN1 domain-co... 59 1e-06 ref|XP_009795588.1| PREDICTED: zinc finger A20 and AN1 domain-co... 59 1e-06 ref|XP_009620573.1| PREDICTED: zinc finger A20 and AN1 domain-co... 59 1e-06 gb|ACM68455.1| stress-associated protein 5 [Solanum pennellii] 59 1e-06 ref|XP_004249192.1| PREDICTED: zinc finger A20 and AN1 domain-co... 59 1e-06 ref|XP_011078867.1| PREDICTED: zinc finger A20 and AN1 domain-co... 59 1e-06 >emb|CDP10084.1| unnamed protein product [Coffea canephora] Length = 263 Score = 66.6 bits (161), Expect = 7e-09 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = -2 Query: 87 DICLMESSKETGCQAPEGPILCINNCGFF 1 DICLMESS+ETGCQAPEGPILCINNCGFF Sbjct: 88 DICLMESSEETGCQAPEGPILCINNCGFF 116 >emb|CDP10083.1| unnamed protein product [Coffea canephora] Length = 216 Score = 65.9 bits (159), Expect = 1e-08 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -2 Query: 90 QDICLMESSKETGCQAPEGPILCINNCGFF 1 QDI LMESSKETGCQAPEGPILCINNCGFF Sbjct: 40 QDIYLMESSKETGCQAPEGPILCINNCGFF 69 >ref|XP_011075194.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 8-like [Sesamum indicum] gi|747057756|ref|XP_011075195.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 8-like [Sesamum indicum] gi|747057758|ref|XP_011075196.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 8-like [Sesamum indicum] Length = 172 Score = 59.3 bits (142), Expect = 1e-06 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -2 Query: 75 MESSKETGCQAPEGPILCINNCGFF 1 MESSKETGCQAPEGPILCINNCGFF Sbjct: 1 MESSKETGCQAPEGPILCINNCGFF 25 >ref|XP_009795588.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 8-like [Nicotiana sylvestris] gi|698419636|ref|XP_009795646.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 8-like [Nicotiana sylvestris] gi|698419642|ref|XP_009795712.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 8-like [Nicotiana sylvestris] Length = 172 Score = 59.3 bits (142), Expect = 1e-06 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -2 Query: 75 MESSKETGCQAPEGPILCINNCGFF 1 MESSKETGCQAPEGPILCINNCGFF Sbjct: 1 MESSKETGCQAPEGPILCINNCGFF 25 >ref|XP_009620573.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 8-like [Nicotiana tomentosiformis] gi|697133045|ref|XP_009620574.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 8-like [Nicotiana tomentosiformis] Length = 172 Score = 59.3 bits (142), Expect = 1e-06 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -2 Query: 75 MESSKETGCQAPEGPILCINNCGFF 1 MESSKETGCQAPEGPILCINNCGFF Sbjct: 1 MESSKETGCQAPEGPILCINNCGFF 25 >gb|ACM68455.1| stress-associated protein 5 [Solanum pennellii] Length = 172 Score = 59.3 bits (142), Expect = 1e-06 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -2 Query: 75 MESSKETGCQAPEGPILCINNCGFF 1 MESSKETGCQAPEGPILCINNCGFF Sbjct: 1 MESSKETGCQAPEGPILCINNCGFF 25 >ref|XP_004249192.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 8-like [Solanum lycopersicum] gi|565369187|ref|XP_006351218.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 8-like isoform X1 [Solanum tuberosum] gi|565369189|ref|XP_006351219.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 8-like isoform X2 [Solanum tuberosum] gi|723738152|ref|XP_010312075.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 8-like [Solanum lycopersicum] gi|222822659|gb|ACM68442.1| stress-associated protein 5 [Solanum lycopersicum] Length = 172 Score = 59.3 bits (142), Expect = 1e-06 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -2 Query: 75 MESSKETGCQAPEGPILCINNCGFF 1 MESSKETGCQAPEGPILCINNCGFF Sbjct: 1 MESSKETGCQAPEGPILCINNCGFF 25 >ref|XP_011078867.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 8-like [Sesamum indicum] Length = 172 Score = 58.9 bits (141), Expect = 1e-06 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = -2 Query: 75 MESSKETGCQAPEGPILCINNCGFF 1 MESSKETGCQAPEGPILC+NNCGFF Sbjct: 1 MESSKETGCQAPEGPILCVNNCGFF 25