BLASTX nr result
ID: Gardenia21_contig00046709
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00046709 (256 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP06470.1| unnamed protein product [Coffea canephora] 82 2e-13 >emb|CDP06470.1| unnamed protein product [Coffea canephora] Length = 723 Score = 81.6 bits (200), Expect = 2e-13 Identities = 37/42 (88%), Positives = 38/42 (90%) Frame = +1 Query: 130 MLAKRLFQKAAALHHHNRPLPPHCAGSCLTPEDVDFRINVHH 255 MLAKRLFQKAAALH H+ P PPH AGSCLTPEDVDFRINVHH Sbjct: 1 MLAKRLFQKAAALHRHHHPPPPHNAGSCLTPEDVDFRINVHH 42