BLASTX nr result
ID: Gardenia21_contig00046530
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00046530 (297 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP10568.1| unnamed protein product [Coffea canephora] 74 4e-11 >emb|CDP10568.1| unnamed protein product [Coffea canephora] Length = 615 Score = 73.9 bits (180), Expect = 4e-11 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = -3 Query: 295 IDYNEFVAMMQRGITDLGKQHLGSRLNLGFRETMQAC 185 IDYNEFVAMM +GITDLGKQHLGS LNLGFRETMQAC Sbjct: 579 IDYNEFVAMMHKGITDLGKQHLGSSLNLGFRETMQAC 615