BLASTX nr result
ID: Gardenia21_contig00046510
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00046510 (230 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME39453.1| hypothetical protein DOTSEDRAFT_38641 [Dothistrom... 56 9e-06 >gb|EME39453.1| hypothetical protein DOTSEDRAFT_38641 [Dothistroma septosporum NZE10] Length = 616 Score = 56.2 bits (134), Expect = 9e-06 Identities = 24/35 (68%), Positives = 31/35 (88%) Frame = -1 Query: 110 MPTHFSEDPPQVMNQADLDLANEKLQERDSSKDNS 6 MP HFSE PPQVMNQADL +ANEKL+ +D+++D+S Sbjct: 1 MPAHFSEGPPQVMNQADLAMANEKLEHQDTAQDDS 35