BLASTX nr result
ID: Gardenia21_contig00044347
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00044347 (217 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_014567597.1| hypothetical protein L969DRAFT_95179 [Mixia ... 81 3e-13 ref|XP_007337421.1| hypothetical protein AURDEDRAFT_156352 [Auri... 57 5e-06 >ref|XP_014567597.1| hypothetical protein L969DRAFT_95179 [Mixia osmundae IAM 14324] gi|358055469|dbj|GAA98589.1| hypothetical protein E5Q_05276 [Mixia osmundae IAM 14324] gi|658164314|gb|KEI39028.1| hypothetical protein L969DRAFT_95179 [Mixia osmundae IAM 14324] Length = 908 Score = 81.3 bits (199), Expect = 3e-13 Identities = 37/69 (53%), Positives = 50/69 (72%) Frame = -3 Query: 215 HFQNKHTSLGLAIFLVLLVQVSLGYFSHAQFDPQRTKRPPWNVAHILLGITLMIMGYVQV 36 HF + HT LGL I ++LL+Q++LG+++HA FDP RT RP N+ HI LGI L I G+VQ+ Sbjct: 731 HFDSFHTRLGLIIGVLLLLQLALGWYTHANFDPLRTHRPAQNITHIFLGIILTIAGFVQI 790 Query: 35 DFGLKIYTR 9 G +IY R Sbjct: 791 KTGFEIYDR 799 >ref|XP_007337421.1| hypothetical protein AURDEDRAFT_156352 [Auricularia subglabra TFB-10046 SS5] gi|393247060|gb|EJD54568.1| hypothetical protein AURDEDRAFT_156352 [Auricularia subglabra TFB-10046 SS5] Length = 300 Score = 57.0 bits (136), Expect = 5e-06 Identities = 26/65 (40%), Positives = 38/65 (58%) Frame = -3 Query: 215 HFQNKHTSLGLAIFLVLLVQVSLGYFSHAQFDPQRTKRPPWNVAHILLGITLMIMGYVQV 36 HF + H GL +F++ +VQ SLG F H +P+R +RPP N H LG+ ++ + QV Sbjct: 171 HFNDMHKKTGLTLFILYVVQASLGAFIHFVKNPKRQRRPPQNYLHAALGLGIVGLALYQV 230 Query: 35 DFGLK 21 G K Sbjct: 231 HLGYK 235