BLASTX nr result
ID: Gardenia21_contig00044298
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00044298 (255 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_002608349.1| orf185 [Vitis vinifera] gi|209954145|emb|CAQ... 99 4e-30 ref|XP_002536610.1| conserved hypothetical protein [Ricinus comm... 93 3e-28 ref|XP_002539035.1| conserved hypothetical protein [Ricinus comm... 93 3e-28 ref|YP_005090367.1| orf186 (mitochondrion) [Phoenix dactylifera]... 93 8e-28 gb|AGC78909.1| hypothetical protein (mitochondrion) [Vicia faba]... 89 5e-27 ref|XP_002530828.1| conserved hypothetical protein [Ricinus comm... 84 7e-25 ref|YP_173489.1| hypothetical protein NitaMp152 [Nicotiana tabac... 99 1e-18 emb|CAN82857.1| hypothetical protein VITISV_008531 [Vitis vinifera] 99 1e-18 gb|KQK85828.1| hypothetical protein SETIT_020741mg [Setaria ital... 85 5e-16 >ref|YP_002608349.1| orf185 [Vitis vinifera] gi|209954145|emb|CAQ77575.1| orf185 [Vitis vinifera] gi|239764756|gb|ACS15226.1| ORF185 [Vitis vinifera] Length = 184 Score = 99.0 bits (245), Expect(2) = 4e-30 Identities = 45/46 (97%), Positives = 45/46 (97%) Frame = -1 Query: 255 VHSLYISDTLGRTRWEGSSPSLCPADHSAGISHSRPRLTAARGCSC 118 VHSLYISDT GRTRWEGSSPSLCPADHSAGISHSRPRLTAARGCSC Sbjct: 79 VHSLYISDTQGRTRWEGSSPSLCPADHSAGISHSRPRLTAARGCSC 124 Score = 59.3 bits (142), Expect(2) = 4e-30 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 85 APPVISFYDMLLSSPYSICHLVISASLR 2 APPVISFYDMLLSSPYSICHLVISASLR Sbjct: 134 APPVISFYDMLLSSPYSICHLVISASLR 161 >ref|XP_002536610.1| conserved hypothetical protein [Ricinus communis] gi|223519108|gb|EEF25773.1| conserved hypothetical protein [Ricinus communis] Length = 184 Score = 92.8 bits (229), Expect(2) = 3e-28 Identities = 43/46 (93%), Positives = 43/46 (93%) Frame = -1 Query: 255 VHSLYISDTLGRTRWEGSSPSLCPADHSAGISHSRPRLTAARGCSC 118 VHSLYISDT GRTRWEGSSPSLCPADHSAGI HSR RLTAARGCSC Sbjct: 79 VHSLYISDTQGRTRWEGSSPSLCPADHSAGILHSRLRLTAARGCSC 124 Score = 59.3 bits (142), Expect(2) = 3e-28 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 85 APPVISFYDMLLSSPYSICHLVISASLR 2 APPVISFYDMLLSSPYSICHLVISASLR Sbjct: 134 APPVISFYDMLLSSPYSICHLVISASLR 161 >ref|XP_002539035.1| conserved hypothetical protein [Ricinus communis] gi|223509127|gb|EEF23347.1| conserved hypothetical protein [Ricinus communis] Length = 124 Score = 92.8 bits (229), Expect(2) = 3e-28 Identities = 43/46 (93%), Positives = 43/46 (93%) Frame = -1 Query: 255 VHSLYISDTLGRTRWEGSSPSLCPADHSAGISHSRPRLTAARGCSC 118 VHSLYISDT GRTRWEGSSPSLCPADHSAGI HSR RLTAARGCSC Sbjct: 19 VHSLYISDTQGRTRWEGSSPSLCPADHSAGILHSRLRLTAARGCSC 64 Score = 59.3 bits (142), Expect(2) = 3e-28 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 85 APPVISFYDMLLSSPYSICHLVISASLR 2 APPVISFYDMLLSSPYSICHLVISASLR Sbjct: 74 APPVISFYDMLLSSPYSICHLVISASLR 101 >ref|YP_005090367.1| orf186 (mitochondrion) [Phoenix dactylifera] gi|343478422|gb|AEM43910.1| orf186 (mitochondrion) [Phoenix dactylifera] Length = 185 Score = 92.8 bits (229), Expect(2) = 8e-28 Identities = 43/46 (93%), Positives = 43/46 (93%) Frame = -1 Query: 255 VHSLYISDTLGRTRWEGSSPSLCPADHSAGISHSRPRLTAARGCSC 118 VHSLYISDT GRTRWEGSSPSLCPADHSAGI HSR RLTAARGCSC Sbjct: 80 VHSLYISDTQGRTRWEGSSPSLCPADHSAGILHSRLRLTAARGCSC 125 Score = 57.8 bits (138), Expect(2) = 8e-28 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = -3 Query: 85 APPVISFYDMLLSSPYSICHLVISASLR 2 APPVISFYDMLLSSPY ICHLVISASLR Sbjct: 135 APPVISFYDMLLSSPYQICHLVISASLR 162 >gb|AGC78909.1| hypothetical protein (mitochondrion) [Vicia faba] gi|442803199|gb|AGC78934.1| hypothetical protein (mitochondrion) [Vicia faba] gi|442803288|gb|AGC79023.1| hypothetical protein (mitochondrion) [Vicia faba] Length = 184 Score = 88.6 bits (218), Expect(2) = 5e-27 Identities = 42/46 (91%), Positives = 42/46 (91%) Frame = -1 Query: 255 VHSLYISDTLGRTRWEGSSPSLCPADHSAGISHSRPRLTAARGCSC 118 VHSLYISDT GRTRWEGSSPSLCPADHSAGI HSR RLTAARG SC Sbjct: 79 VHSLYISDTQGRTRWEGSSPSLCPADHSAGILHSRLRLTAARGWSC 124 Score = 59.3 bits (142), Expect(2) = 5e-27 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 85 APPVISFYDMLLSSPYSICHLVISASLR 2 APPVISFYDMLLSSPYSICHLVISASLR Sbjct: 134 APPVISFYDMLLSSPYSICHLVISASLR 161 >ref|XP_002530828.1| conserved hypothetical protein [Ricinus communis] gi|223529592|gb|EEF31541.1| conserved hypothetical protein [Ricinus communis] Length = 229 Score = 83.6 bits (205), Expect(2) = 7e-25 Identities = 38/46 (82%), Positives = 39/46 (84%) Frame = -1 Query: 255 VHSLYISDTLGRTRWEGSSPSLCPADHSAGISHSRPRLTAARGCSC 118 VHSLYISDT G+T WEGSSPSLCP DHSAGI HSR LT ARGCSC Sbjct: 124 VHSLYISDTQGKTWWEGSSPSLCPVDHSAGILHSRLHLTTARGCSC 169 Score = 57.0 bits (136), Expect(2) = 7e-25 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = -3 Query: 85 APPVISFYDMLLSSPYSICHLVISASLR 2 APPVISFYDMLLS PYSICHLVISASLR Sbjct: 179 APPVISFYDMLLSLPYSICHLVISASLR 206 >ref|YP_173489.1| hypothetical protein NitaMp152 [Nicotiana tabacum] gi|675895163|ref|YP_009049637.1| hypothetical protein (mitochondrion) [Capsicum annuum] gi|56806654|dbj|BAD83555.1| hypothetical protein (mitochondrion) [Nicotiana tabacum] gi|667751898|gb|AIG89985.1| hypothetical protein (mitochondrion) [Capsicum annuum] gi|667751909|gb|AIG89995.1| hypothetical protein (mitochondrion) [Capsicum annuum] Length = 125 Score = 99.0 bits (245), Expect = 1e-18 Identities = 45/46 (97%), Positives = 45/46 (97%) Frame = -1 Query: 255 VHSLYISDTLGRTRWEGSSPSLCPADHSAGISHSRPRLTAARGCSC 118 VHSLYISDT GRTRWEGSSPSLCPADHSAGISHSRPRLTAARGCSC Sbjct: 79 VHSLYISDTQGRTRWEGSSPSLCPADHSAGISHSRPRLTAARGCSC 124 >emb|CAN82857.1| hypothetical protein VITISV_008531 [Vitis vinifera] Length = 145 Score = 99.0 bits (245), Expect = 1e-18 Identities = 45/46 (97%), Positives = 45/46 (97%) Frame = -1 Query: 255 VHSLYISDTLGRTRWEGSSPSLCPADHSAGISHSRPRLTAARGCSC 118 VHSLYISDT GRTRWEGSSPSLCPADHSAGISHSRPRLTAARGCSC Sbjct: 79 VHSLYISDTQGRTRWEGSSPSLCPADHSAGISHSRPRLTAARGCSC 124 >gb|KQK85828.1| hypothetical protein SETIT_020741mg [Setaria italica] Length = 81 Score = 85.1 bits (209), Expect(2) = 5e-16 Identities = 40/46 (86%), Positives = 40/46 (86%) Frame = -1 Query: 255 VHSLYISDTLGRTRWEGSSPSLCPADHSAGISHSRPRLTAARGCSC 118 VHSLYISDT GRTRWE SSPSLCP DHSAGI HSR RLTAAR CSC Sbjct: 16 VHSLYISDTQGRTRWEESSPSLCPVDHSAGILHSRLRLTAARECSC 61 Score = 25.8 bits (55), Expect(2) = 5e-16 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = -3 Query: 85 APPVISFYDML 53 APP+ISFYDML Sbjct: 71 APPLISFYDML 81