BLASTX nr result
ID: Gardenia21_contig00043533
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00043533 (291 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007356002.1| hypothetical protein AURDEDRAFT_43801, parti... 59 2e-06 >ref|XP_007356002.1| hypothetical protein AURDEDRAFT_43801, partial [Auricularia subglabra TFB-10046 SS5] gi|393228231|gb|EJD35882.1| hypothetical protein AURDEDRAFT_43801, partial [Auricularia subglabra TFB-10046 SS5] Length = 197 Score = 58.5 bits (140), Expect = 2e-06 Identities = 37/96 (38%), Positives = 48/96 (50%) Frame = -3 Query: 289 PIFDIGSHFGHETDMLIRSPAIGLQLAKTFEPIIEEXXXXXXXXXXXXSGIFSRKSKQVE 110 P FDI + FG TDML+RSPAIG LA+ F P S S + Sbjct: 112 PNFDIAAQFGAGTDMLVRSPAIGSALAQMFVPSA------------------SVASSGIN 153 Query: 109 EPVIPVVKPRAMVLMRGHGATIVAPTLKLVVQRAIY 2 V+P VLMRGHG T+V +++L V R++Y Sbjct: 154 STVLP------FVLMRGHGGTVVGASIQLAVFRSVY 183