BLASTX nr result
ID: Gardenia21_contig00042730
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00042730 (223 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP12542.1| unnamed protein product [Coffea canephora] 117 3e-24 emb|CDP12540.1| unnamed protein product [Coffea canephora] 92 1e-16 >emb|CDP12542.1| unnamed protein product [Coffea canephora] Length = 556 Score = 117 bits (293), Expect = 3e-24 Identities = 52/73 (71%), Positives = 61/73 (83%) Frame = +2 Query: 2 LYLGPNSNKYYVEDESIIRFGIDSLKIRVSDPGMQKNNCSSFPLYSITQYSYSPLHPPES 181 LYLG NSNKYYVE++SI+ FG S +I V DPG+QKNNCSS PLYSIT YSY+PLHPPE Sbjct: 79 LYLGSNSNKYYVEEKSIMNFGSSSKRIHVIDPGVQKNNCSSLPLYSITHYSYNPLHPPEP 138 Query: 182 SDSIIFVRCKKPV 220 DSI+FV CK+P+ Sbjct: 139 HDSIVFVSCKRPI 151 >emb|CDP12540.1| unnamed protein product [Coffea canephora] Length = 629 Score = 92.4 bits (228), Expect = 1e-16 Identities = 44/73 (60%), Positives = 55/73 (75%) Frame = +2 Query: 2 LYLGPNSNKYYVEDESIIRFGIDSLKIRVSDPGMQKNNCSSFPLYSITQYSYSPLHPPES 181 LYLGPNSNKYYV +ESI++ + S IR+ DPG+ KNNCS+ PLYSI +SYSPL P Sbjct: 73 LYLGPNSNKYYVAEESIMKI-MRSKSIRIMDPGVVKNNCSTVPLYSILDFSYSPLSPGSD 131 Query: 182 SDSIIFVRCKKPV 220 + +IFV CK+PV Sbjct: 132 AFLLIFVTCKRPV 144