BLASTX nr result
ID: Gardenia21_contig00042613
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00042613 (283 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDP35707.1| hypothetical protein JCGZ_10479 [Jatropha curcas] 63 1e-07 ref|XP_003616146.2| hypothetical protein MTR_5g076600 [Medicago ... 58 2e-06 dbj|BAT09346.1| Os09g0555450 [Oryza sativa Japonica Group] 57 7e-06 >gb|KDP35707.1| hypothetical protein JCGZ_10479 [Jatropha curcas] Length = 60 Score = 62.8 bits (151), Expect = 1e-07 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = -1 Query: 211 LLVLASTTYDVHRSIKNNDRPPSKEDMEALEDYVR 107 ++ LASTTYDVHRSIKNN+ PPSKE MEALEDY+R Sbjct: 20 VVFLASTTYDVHRSIKNNETPPSKEQMEALEDYIR 54 >ref|XP_003616146.2| hypothetical protein MTR_5g076600 [Medicago truncatula] gi|657385459|gb|AES99104.2| hypothetical protein MTR_5g076600 [Medicago truncatula] Length = 60 Score = 58.2 bits (139), Expect = 2e-06 Identities = 25/35 (71%), Positives = 32/35 (91%) Frame = -1 Query: 211 LLVLASTTYDVHRSIKNNDRPPSKEDMEALEDYVR 107 LL LASTTYDVHRSIKNN+ PPS+E ++ALE+Y++ Sbjct: 20 LLFLASTTYDVHRSIKNNETPPSEEQLKALEEYIK 54 >dbj|BAT09346.1| Os09g0555450 [Oryza sativa Japonica Group] Length = 113 Score = 56.6 bits (135), Expect = 7e-06 Identities = 23/34 (67%), Positives = 31/34 (91%) Frame = -1 Query: 211 LLVLASTTYDVHRSIKNNDRPPSKEDMEALEDYV 110 ++ L +TTYDVHRSIKNN++PP+KE MEAL+DY+ Sbjct: 74 VVFLGATTYDVHRSIKNNEQPPTKEQMEALQDYI 107