BLASTX nr result
ID: Gardenia21_contig00041972
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00041972 (779 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP03010.1| unnamed protein product [Coffea canephora] 82 3e-13 >emb|CDP03010.1| unnamed protein product [Coffea canephora] Length = 340 Score = 82.4 bits (202), Expect = 3e-13 Identities = 48/104 (46%), Positives = 58/104 (55%), Gaps = 1/104 (0%) Frame = -3 Query: 333 GMSTPILEEIDGLLYILCRPCTLT-GRYTLDPCFEVYDPRTNKWSPLETPPFYEYTSKYF 157 G PI+ EI GL+Y L RP L GR + FEVYDP N+W+ L+ PPF Sbjct: 94 GKILPIVVEIGGLIYALSRPPILDYGRR--ETVFEVYDPAKNEWTGLDGPPFLSP----- 146 Query: 156 FRRNPHPSSRVVIDKKLCVSTRYASFAYNTRSGKWETCELFVGF 25 F P S VVID KLCVS R S A++T + WE C+ F GF Sbjct: 147 FTFGAFPYSYVVIDNKLCVSNRAGSCAFDTENWTWEACDFFAGF 190