BLASTX nr result
ID: Gardenia21_contig00041862
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00041862 (427 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP00460.1| unnamed protein product [Coffea canephora] 59 1e-06 >emb|CDP00460.1| unnamed protein product [Coffea canephora] Length = 451 Score = 58.9 bits (141), Expect = 1e-06 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = +2 Query: 326 MPSFDRETADNMKVSETNFSNRMEKLLLGNPGLG 427 MPSFDRET DNM+V ET+FSNR EKLL NPGLG Sbjct: 1 MPSFDRETVDNMEVLETDFSNRTEKLLFANPGLG 34