BLASTX nr result
ID: Gardenia21_contig00041837
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00041837 (422 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP15795.1| unnamed protein product [Coffea canephora] 49 2e-07 emb|CDP15793.1| unnamed protein product [Coffea canephora] 45 6e-07 >emb|CDP15795.1| unnamed protein product [Coffea canephora] Length = 173 Score = 48.5 bits (114), Expect(2) = 2e-07 Identities = 23/51 (45%), Positives = 36/51 (70%) Frame = -1 Query: 365 IFDGGLSRENVDYTVHRNDAQGTYGTLRLSYSFGESTQIFDAQGQASSMGE 213 +FD G S+EN++Y V RNDA G +G L+LSY F + T+I ++ ++S G+ Sbjct: 101 LFDCGFSQENLEYDVDRNDADGIFGKLKLSYDFAK-TKITVSKSESSLRGQ 150 Score = 33.5 bits (75), Expect(2) = 2e-07 Identities = 14/21 (66%), Positives = 18/21 (85%) Frame = -2 Query: 421 KLYCQRSLHKDQYVGEVNIFL 359 +LYC+RSL D+YVGEVN+ L Sbjct: 78 ELYCERSLLPDKYVGEVNLSL 98 >emb|CDP15793.1| unnamed protein product [Coffea canephora] Length = 183 Score = 45.1 bits (105), Expect(2) = 6e-07 Identities = 18/37 (48%), Positives = 27/37 (72%) Frame = -1 Query: 365 IFDGGLSRENVDYTVHRNDAQGTYGTLRLSYSFGEST 255 +FD G +E ++Y V+RND G +G L+LSY FG++T Sbjct: 101 LFDYGFPQEKLEYYVNRNDVDGKFGKLKLSYDFGKTT 137 Score = 35.0 bits (79), Expect(2) = 6e-07 Identities = 15/21 (71%), Positives = 18/21 (85%) Frame = -2 Query: 421 KLYCQRSLHKDQYVGEVNIFL 359 KLYC+RSL D+YVGEVN+ L Sbjct: 78 KLYCERSLLPDKYVGEVNLSL 98