BLASTX nr result
ID: Gardenia21_contig00040535
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00040535 (446 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KOM28525.1| hypothetical protein LR48_Vigan549s008000 [Vigna ... 56 9e-06 >gb|KOM28525.1| hypothetical protein LR48_Vigan549s008000 [Vigna angularis] Length = 94 Score = 56.2 bits (134), Expect = 9e-06 Identities = 26/60 (43%), Positives = 36/60 (60%) Frame = -3 Query: 333 CHDALVVPCGEAMATSKPPSSTCCANLQKQWEACYCTLTKVPEGRAFIASPHVAKVLETC 154 C + + PC A+ +S PPSSTCCA L +Q + C C K P + ++ SP+ KVL TC Sbjct: 29 CSASQLTPCIPAITSSSPPSSTCCAKLNEQ-KPCLCGYLKNPALKQYVNSPNAKKVLSTC 87