BLASTX nr result
ID: Gardenia21_contig00040478
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00040478 (426 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP15232.1| unnamed protein product [Coffea canephora] 108 1e-21 ref|XP_004231300.1| PREDICTED: putative pentatricopeptide repeat... 72 2e-10 ref|XP_009777346.1| PREDICTED: putative pentatricopeptide repeat... 68 2e-09 ref|XP_006344789.1| PREDICTED: putative pentatricopeptide repeat... 67 4e-09 ref|XP_009587948.1| PREDICTED: putative pentatricopeptide repeat... 62 1e-07 ref|XP_010659715.1| PREDICTED: putative pentatricopeptide repeat... 61 4e-07 emb|CBI39620.3| unnamed protein product [Vitis vinifera] 61 4e-07 ref|XP_002277327.1| PREDICTED: putative pentatricopeptide repeat... 61 4e-07 ref|XP_008450526.1| PREDICTED: putative pentatricopeptide repeat... 60 8e-07 ref|XP_008246376.1| PREDICTED: putative pentatricopeptide repeat... 57 4e-06 ref|XP_010024148.1| PREDICTED: putative pentatricopeptide repeat... 57 4e-06 ref|XP_011659402.1| PREDICTED: putative pentatricopeptide repeat... 57 7e-06 ref|XP_009337652.1| PREDICTED: putative pentatricopeptide repeat... 56 9e-06 >emb|CDP15232.1| unnamed protein product [Coffea canephora] Length = 609 Score = 108 bits (271), Expect = 1e-21 Identities = 52/61 (85%), Positives = 56/61 (91%) Frame = -2 Query: 185 MSARKLVSTIFNYQIPQTVRNSLRWPQTEATHLSPPFLPKPPSYLATNIIKSYFQNGQIQ 6 MSARK VSTIFN+QIPQT+RNSL W QTEAT LS PFLPKPPSYLATNIIKSYF+NGQIQ Sbjct: 1 MSARKRVSTIFNHQIPQTIRNSLHWLQTEATDLSQPFLPKPPSYLATNIIKSYFENGQIQ 60 Query: 5 D 3 + Sbjct: 61 E 61 >ref|XP_004231300.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g56570 [Solanum lycopersicum] Length = 608 Score = 71.6 bits (174), Expect = 2e-10 Identities = 34/61 (55%), Positives = 44/61 (72%) Frame = -2 Query: 185 MSARKLVSTIFNYQIPQTVRNSLRWPQTEATHLSPPFLPKPPSYLATNIIKSYFQNGQIQ 6 M+ARKLVS QIPQT++NSL + H +PPFLPKPPS LAT ++KSYF+ G I+ Sbjct: 1 MNARKLVSQTHCTQIPQTIKNSLLCAAIDPPHSNPPFLPKPPSILATGLLKSYFERGLIR 60 Query: 5 D 3 + Sbjct: 61 E 61 >ref|XP_009777346.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g56570 [Nicotiana sylvestris] Length = 608 Score = 68.2 bits (165), Expect = 2e-09 Identities = 34/61 (55%), Positives = 42/61 (68%) Frame = -2 Query: 185 MSARKLVSTIFNYQIPQTVRNSLRWPQTEATHLSPPFLPKPPSYLATNIIKSYFQNGQIQ 6 M+ARKLV QIPQT+RNSL T +PPFLPKPPS LAT ++KSYF+ G I+ Sbjct: 1 MNARKLVFQTHCTQIPQTIRNSLLCAGTNPPSSNPPFLPKPPSVLATGLLKSYFERGLIR 60 Query: 5 D 3 + Sbjct: 61 E 61 >ref|XP_006344789.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g56570-like [Solanum tuberosum] Length = 605 Score = 67.4 bits (163), Expect = 4e-09 Identities = 33/61 (54%), Positives = 44/61 (72%) Frame = -2 Query: 185 MSARKLVSTIFNYQIPQTVRNSLRWPQTEATHLSPPFLPKPPSYLATNIIKSYFQNGQIQ 6 M+ARKLVS QIPQT++NSL + H +PPF+PKPPS LAT ++KSYF+ G I+ Sbjct: 1 MNARKLVSQT---QIPQTIKNSLLCAAIDPPHSNPPFVPKPPSILATGLLKSYFERGLIR 57 Query: 5 D 3 + Sbjct: 58 E 58 >ref|XP_009587948.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g56570 [Nicotiana tomentosiformis] Length = 610 Score = 62.4 bits (150), Expect = 1e-07 Identities = 31/61 (50%), Positives = 41/61 (67%) Frame = -2 Query: 185 MSARKLVSTIFNYQIPQTVRNSLRWPQTEATHLSPPFLPKPPSYLATNIIKSYFQNGQIQ 6 M+ARKLVS QIPQT+RNSL + + PFLPKPPS LAT ++K YF+ G ++ Sbjct: 1 MNARKLVSQTHYTQIPQTIRNSLLCAGICPPYSNSPFLPKPPSILATGLLKLYFERGLVR 60 Query: 5 D 3 + Sbjct: 61 E 61 >ref|XP_010659715.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g56570 isoform X1 [Vitis vinifera] Length = 608 Score = 60.8 bits (146), Expect = 4e-07 Identities = 32/59 (54%), Positives = 39/59 (66%) Frame = -2 Query: 185 MSARKLVSTIFNYQIPQTVRNSLRWPQTEATHLSPPFLPKPPSYLATNIIKSYFQNGQI 9 MS RKL+ST + IP VRNS++ Q T +PPF+PK PS LAT +IKSYF G I Sbjct: 1 MSTRKLLSTTHFHPIPLIVRNSIQLVQNCTTPPNPPFIPKGPSVLATTLIKSYFGKGLI 59 >emb|CBI39620.3| unnamed protein product [Vitis vinifera] Length = 591 Score = 60.8 bits (146), Expect = 4e-07 Identities = 32/59 (54%), Positives = 39/59 (66%) Frame = -2 Query: 185 MSARKLVSTIFNYQIPQTVRNSLRWPQTEATHLSPPFLPKPPSYLATNIIKSYFQNGQI 9 MS RKL+ST + IP VRNS++ Q T +PPF+PK PS LAT +IKSYF G I Sbjct: 1 MSTRKLLSTTHFHPIPLIVRNSIQLVQNCTTPPNPPFIPKGPSVLATTLIKSYFGKGLI 59 >ref|XP_002277327.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g56570 isoform X2 [Vitis vinifera] Length = 607 Score = 60.8 bits (146), Expect = 4e-07 Identities = 32/59 (54%), Positives = 39/59 (66%) Frame = -2 Query: 185 MSARKLVSTIFNYQIPQTVRNSLRWPQTEATHLSPPFLPKPPSYLATNIIKSYFQNGQI 9 MS RKL+ST + IP VRNS++ Q T +PPF+PK PS LAT +IKSYF G I Sbjct: 1 MSTRKLLSTTHFHPIPLIVRNSIQLVQNCTTPPNPPFIPKGPSVLATTLIKSYFGKGLI 59 >ref|XP_008450526.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g56570 [Cucumis melo] gi|659099294|ref|XP_008450527.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g56570 [Cucumis melo] gi|659099296|ref|XP_008450528.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g56570 [Cucumis melo] gi|659099298|ref|XP_008450529.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g56570 [Cucumis melo] gi|659099300|ref|XP_008450530.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g56570 [Cucumis melo] gi|659099302|ref|XP_008450531.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g56570 [Cucumis melo] gi|659099304|ref|XP_008450532.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g56570 [Cucumis melo] Length = 606 Score = 59.7 bits (143), Expect = 8e-07 Identities = 29/57 (50%), Positives = 35/57 (61%) Frame = -2 Query: 185 MSARKLVSTIFNYQIPQTVRNSLRWPQTEATHLSPPFLPKPPSYLATNIIKSYFQNG 15 MS KL S+ + IP VRNSL+W +PPF PK PS+ ATN+IKSYF G Sbjct: 1 MSVDKLASSPHFHPIPLIVRNSLQWISNSTLQSNPPFTPKGPSFWATNLIKSYFDKG 57 >ref|XP_008246376.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g56570 [Prunus mume] Length = 615 Score = 57.4 bits (137), Expect = 4e-06 Identities = 27/61 (44%), Positives = 40/61 (65%) Frame = -2 Query: 185 MSARKLVSTIFNYQIPQTVRNSLRWPQTEATHLSPPFLPKPPSYLATNIIKSYFQNGQIQ 6 MS +K +S + +P +RNSL+W + TH + FLPK P+ LATN+IKS F+ G I+ Sbjct: 1 MSTQKSLSRTHFHLMPPIIRNSLQWARNFTTHSNTSFLPKRPNILATNLIKSCFERGLIK 60 Query: 5 D 3 + Sbjct: 61 E 61 >ref|XP_010024148.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g56570 [Eucalyptus grandis] gi|629094581|gb|KCW60576.1| hypothetical protein EUGRSUZ_H03307 [Eucalyptus grandis] Length = 606 Score = 57.4 bits (137), Expect = 4e-06 Identities = 28/61 (45%), Positives = 42/61 (68%) Frame = -2 Query: 185 MSARKLVSTIFNYQIPQTVRNSLRWPQTEATHLSPPFLPKPPSYLATNIIKSYFQNGQIQ 6 MSA+KL+ST IP V NSLR + T +PPFL K PS L+T+++K+YF++G ++ Sbjct: 1 MSAKKLLSTTHYRPIPNVVLNSLRRVRNCITQPNPPFLRKDPSVLSTDLVKTYFESGLVK 60 Query: 5 D 3 + Sbjct: 61 E 61 >ref|XP_011659402.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g56570 [Cucumis sativus] gi|700210882|gb|KGN65978.1| hypothetical protein Csa_1G555630 [Cucumis sativus] Length = 606 Score = 56.6 bits (135), Expect = 7e-06 Identities = 28/57 (49%), Positives = 34/57 (59%) Frame = -2 Query: 185 MSARKLVSTIFNYQIPQTVRNSLRWPQTEATHLSPPFLPKPPSYLATNIIKSYFQNG 15 MS KL S+ + IP VRNSL+W +PPF P+ PS ATN+IKSYF G Sbjct: 1 MSVDKLASSPHFHPIPLIVRNSLQWISNSTLQSNPPFTPEGPSVWATNLIKSYFDKG 57 >ref|XP_009337652.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g56570 [Pyrus x bretschneideri] Length = 609 Score = 56.2 bits (134), Expect = 9e-06 Identities = 30/64 (46%), Positives = 42/64 (65%), Gaps = 3/64 (4%) Frame = -2 Query: 185 MSARKLVS---TIFNYQIPQTVRNSLRWPQTEATHLSPPFLPKPPSYLATNIIKSYFQNG 15 MS ++L+ T+F + IP RNSL+W Q T +PPF PK P+ LATN+IKS+F G Sbjct: 1 MSTKRLLVLPITLF-HPIPPITRNSLQWVQDFTTQSTPPFSPKIPNILATNLIKSHFDKG 59 Query: 14 QIQD 3 I++ Sbjct: 60 LIKE 63