BLASTX nr result
ID: Gardenia21_contig00040330
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00040330 (255 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP09178.1| unnamed protein product [Coffea canephora] 99 9e-19 gb|KDO44240.1| hypothetical protein CISIN_1g035659mg [Citrus sin... 88 3e-15 ref|XP_006480615.1| PREDICTED: pentatricopeptide repeat-containi... 87 4e-15 ref|XP_006428806.1| hypothetical protein CICLE_v10011151mg [Citr... 87 4e-15 ref|XP_012067781.1| PREDICTED: pentatricopeptide repeat-containi... 86 8e-15 ref|XP_011032289.1| PREDICTED: pentatricopeptide repeat-containi... 86 8e-15 gb|KDP46510.1| hypothetical protein JCGZ_08482 [Jatropha curcas] 86 8e-15 ref|XP_002314110.1| pentatricopeptide repeat-containing family p... 86 8e-15 ref|XP_012844174.1| PREDICTED: pentatricopeptide repeat-containi... 85 2e-14 gb|EYU45383.1| hypothetical protein MIMGU_mgv1a023657mg [Erythra... 85 2e-14 ref|XP_012447691.1| PREDICTED: pentatricopeptide repeat-containi... 84 3e-14 gb|KHN23911.1| Pentatricopeptide repeat-containing protein, chlo... 84 4e-14 ref|XP_009607911.1| PREDICTED: pentatricopeptide repeat-containi... 84 4e-14 ref|XP_006575137.1| PREDICTED: pentatricopeptide repeat-containi... 84 4e-14 ref|XP_003520267.1| PREDICTED: pentatricopeptide repeat-containi... 84 4e-14 emb|CBI15973.3| unnamed protein product [Vitis vinifera] 84 5e-14 ref|XP_002279360.1| PREDICTED: pentatricopeptide repeat-containi... 84 5e-14 ref|XP_012857778.1| PREDICTED: pentatricopeptide repeat-containi... 83 7e-14 gb|EYU44038.1| hypothetical protein MIMGU_mgv1a001643mg [Erythra... 83 7e-14 ref|XP_013648524.1| PREDICTED: pentatricopeptide repeat-containi... 83 9e-14 >emb|CDP09178.1| unnamed protein product [Coffea canephora] Length = 741 Score = 99.4 bits (246), Expect = 9e-19 Identities = 42/43 (97%), Positives = 42/43 (97%) Frame = -1 Query: 255 RICGDCHAAAKLISKLYKREIVLRDCYRFHHFKGGSCSCMDYW 127 RICGDCHAAAKLISKLY REIVLRDCYRFHHFKGGSCSCMDYW Sbjct: 699 RICGDCHAAAKLISKLYNREIVLRDCYRFHHFKGGSCSCMDYW 741 >gb|KDO44240.1| hypothetical protein CISIN_1g035659mg [Citrus sinensis] Length = 655 Score = 87.8 bits (216), Expect = 3e-15 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = -1 Query: 255 RICGDCHAAAKLISKLYKREIVLRDCYRFHHFKGGSCSCMDYW 127 R+CGDCH AKLISKLY REI+LRD YRFHHF+GG+CSCMDYW Sbjct: 613 RVCGDCHTVAKLISKLYNREILLRDRYRFHHFRGGNCSCMDYW 655 >ref|XP_006480615.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic-like [Citrus sinensis] Length = 746 Score = 87.4 bits (215), Expect = 4e-15 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = -1 Query: 255 RICGDCHAAAKLISKLYKREIVLRDCYRFHHFKGGSCSCMDYW 127 R+CGDCH+ AKLISKLY REI+LRD YRFHHF GG+CSCMDYW Sbjct: 704 RVCGDCHSVAKLISKLYNREILLRDRYRFHHFSGGNCSCMDYW 746 >ref|XP_006428806.1| hypothetical protein CICLE_v10011151mg [Citrus clementina] gi|557530863|gb|ESR42046.1| hypothetical protein CICLE_v10011151mg [Citrus clementina] Length = 737 Score = 87.4 bits (215), Expect = 4e-15 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = -1 Query: 255 RICGDCHAAAKLISKLYKREIVLRDCYRFHHFKGGSCSCMDYW 127 R+CGDCH+ AKLISKLY REI+LRD YRFHHF GG+CSCMDYW Sbjct: 695 RVCGDCHSVAKLISKLYNREILLRDRYRFHHFSGGNCSCMDYW 737 >ref|XP_012067781.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic [Jatropha curcas] Length = 739 Score = 86.3 bits (212), Expect = 8e-15 Identities = 34/43 (79%), Positives = 39/43 (90%) Frame = -1 Query: 255 RICGDCHAAAKLISKLYKREIVLRDCYRFHHFKGGSCSCMDYW 127 R+CGDCH+ AKLISKLY R+I+LRD YRFHHF GG+CSCMDYW Sbjct: 697 RVCGDCHSVAKLISKLYNRDILLRDRYRFHHFSGGNCSCMDYW 739 >ref|XP_011032289.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic [Populus euphratica] Length = 1165 Score = 86.3 bits (212), Expect = 8e-15 Identities = 34/43 (79%), Positives = 39/43 (90%) Frame = -1 Query: 255 RICGDCHAAAKLISKLYKREIVLRDCYRFHHFKGGSCSCMDYW 127 R+CGDCH+ AKLISKLY R+I+LRD YRFHHF GG+CSCMDYW Sbjct: 696 RVCGDCHSVAKLISKLYNRDILLRDRYRFHHFSGGNCSCMDYW 738 >gb|KDP46510.1| hypothetical protein JCGZ_08482 [Jatropha curcas] Length = 686 Score = 86.3 bits (212), Expect = 8e-15 Identities = 34/43 (79%), Positives = 39/43 (90%) Frame = -1 Query: 255 RICGDCHAAAKLISKLYKREIVLRDCYRFHHFKGGSCSCMDYW 127 R+CGDCH+ AKLISKLY R+I+LRD YRFHHF GG+CSCMDYW Sbjct: 644 RVCGDCHSVAKLISKLYNRDILLRDRYRFHHFSGGNCSCMDYW 686 >ref|XP_002314110.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|222850518|gb|EEE88065.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 738 Score = 86.3 bits (212), Expect = 8e-15 Identities = 34/43 (79%), Positives = 39/43 (90%) Frame = -1 Query: 255 RICGDCHAAAKLISKLYKREIVLRDCYRFHHFKGGSCSCMDYW 127 R+CGDCH+ AKLISKLY R+I+LRD YRFHHF GG+CSCMDYW Sbjct: 696 RVCGDCHSVAKLISKLYNRDILLRDRYRFHHFSGGNCSCMDYW 738 >ref|XP_012844174.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic [Erythranthe guttatus] Length = 748 Score = 84.7 bits (208), Expect = 2e-14 Identities = 34/43 (79%), Positives = 38/43 (88%) Frame = -1 Query: 255 RICGDCHAAAKLISKLYKREIVLRDCYRFHHFKGGSCSCMDYW 127 R+C DCH+ KL+SKLY REIVLRD YRFHHF+GGSCSCMDYW Sbjct: 706 RVCEDCHSVIKLVSKLYDREIVLRDRYRFHHFRGGSCSCMDYW 748 >gb|EYU45383.1| hypothetical protein MIMGU_mgv1a023657mg [Erythranthe guttata] Length = 701 Score = 84.7 bits (208), Expect = 2e-14 Identities = 34/43 (79%), Positives = 38/43 (88%) Frame = -1 Query: 255 RICGDCHAAAKLISKLYKREIVLRDCYRFHHFKGGSCSCMDYW 127 R+C DCH+ KL+SKLY REIVLRD YRFHHF+GGSCSCMDYW Sbjct: 659 RVCEDCHSVIKLVSKLYDREIVLRDRYRFHHFRGGSCSCMDYW 701 >ref|XP_012447691.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic [Gossypium raimondii] gi|763788764|gb|KJB55760.1| hypothetical protein B456_009G092600 [Gossypium raimondii] Length = 733 Score = 84.3 bits (207), Expect = 3e-14 Identities = 32/43 (74%), Positives = 38/43 (88%) Frame = -1 Query: 255 RICGDCHAAAKLISKLYKREIVLRDCYRFHHFKGGSCSCMDYW 127 R+CGDCH+ AKL+S+LY REI+LRD YRFHHF GG+CSC DYW Sbjct: 691 RVCGDCHSVAKLVSRLYNREIILRDRYRFHHFSGGNCSCKDYW 733 >gb|KHN23911.1| Pentatricopeptide repeat-containing protein, chloroplastic [Glycine soja] Length = 384 Score = 84.0 bits (206), Expect = 4e-14 Identities = 33/43 (76%), Positives = 39/43 (90%) Frame = -1 Query: 255 RICGDCHAAAKLISKLYKREIVLRDCYRFHHFKGGSCSCMDYW 127 RICGDCHA AKL+S+LY R+I+LRD YRFHHF+GG CSC+DYW Sbjct: 342 RICGDCHAFAKLVSQLYDRDILLRDRYRFHHFRGGKCSCLDYW 384 >ref|XP_009607911.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic [Nicotiana tomentosiformis] Length = 743 Score = 84.0 bits (206), Expect = 4e-14 Identities = 34/43 (79%), Positives = 38/43 (88%) Frame = -1 Query: 255 RICGDCHAAAKLISKLYKREIVLRDCYRFHHFKGGSCSCMDYW 127 R+CGDCHA AKL+SKLY REI+LRD YRFHHFK G+CSC DYW Sbjct: 701 RVCGDCHAVAKLLSKLYDREILLRDRYRFHHFKEGNCSCKDYW 743 >ref|XP_006575137.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic-like isoform X2 [Glycine max] gi|947123433|gb|KRH71639.1| hypothetical protein GLYMA_02G160400 [Glycine max] Length = 695 Score = 84.0 bits (206), Expect = 4e-14 Identities = 33/43 (76%), Positives = 39/43 (90%) Frame = -1 Query: 255 RICGDCHAAAKLISKLYKREIVLRDCYRFHHFKGGSCSCMDYW 127 RICGDCHA AKL+S+LY R+I+LRD YRFHHF+GG CSC+DYW Sbjct: 653 RICGDCHAFAKLVSQLYDRDILLRDRYRFHHFRGGKCSCLDYW 695 >ref|XP_003520267.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic-like isoform X1 [Glycine max] gi|947123432|gb|KRH71638.1| hypothetical protein GLYMA_02G160400 [Glycine max] Length = 780 Score = 84.0 bits (206), Expect = 4e-14 Identities = 33/43 (76%), Positives = 39/43 (90%) Frame = -1 Query: 255 RICGDCHAAAKLISKLYKREIVLRDCYRFHHFKGGSCSCMDYW 127 RICGDCHA AKL+S+LY R+I+LRD YRFHHF+GG CSC+DYW Sbjct: 738 RICGDCHAFAKLVSQLYDRDILLRDRYRFHHFRGGKCSCLDYW 780 >emb|CBI15973.3| unnamed protein product [Vitis vinifera] Length = 652 Score = 83.6 bits (205), Expect = 5e-14 Identities = 33/43 (76%), Positives = 38/43 (88%) Frame = -1 Query: 255 RICGDCHAAAKLISKLYKREIVLRDCYRFHHFKGGSCSCMDYW 127 R+CGDCH+ AKL+SKLY REI+LRD YRFHHF+ G CSCMDYW Sbjct: 610 RVCGDCHSVAKLVSKLYDREILLRDRYRFHHFREGHCSCMDYW 652 >ref|XP_002279360.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic [Vitis vinifera] Length = 743 Score = 83.6 bits (205), Expect = 5e-14 Identities = 33/43 (76%), Positives = 38/43 (88%) Frame = -1 Query: 255 RICGDCHAAAKLISKLYKREIVLRDCYRFHHFKGGSCSCMDYW 127 R+CGDCH+ AKL+SKLY REI+LRD YRFHHF+ G CSCMDYW Sbjct: 701 RVCGDCHSVAKLVSKLYDREILLRDRYRFHHFREGHCSCMDYW 743 >ref|XP_012857778.1| PREDICTED: pentatricopeptide repeat-containing protein At3g62890-like [Erythranthe guttatus] Length = 796 Score = 83.2 bits (204), Expect = 7e-14 Identities = 34/43 (79%), Positives = 39/43 (90%) Frame = -1 Query: 255 RICGDCHAAAKLISKLYKREIVLRDCYRFHHFKGGSCSCMDYW 127 RICGDCHAAAKL+S+ + REIV+RD +RFHHFK GSCSCMDYW Sbjct: 754 RICGDCHAAAKLVSEAFDREIVIRDRHRFHHFKHGSCSCMDYW 796 >gb|EYU44038.1| hypothetical protein MIMGU_mgv1a001643mg [Erythranthe guttata] Length = 780 Score = 83.2 bits (204), Expect = 7e-14 Identities = 34/43 (79%), Positives = 39/43 (90%) Frame = -1 Query: 255 RICGDCHAAAKLISKLYKREIVLRDCYRFHHFKGGSCSCMDYW 127 RICGDCHAAAKL+S+ + REIV+RD +RFHHFK GSCSCMDYW Sbjct: 738 RICGDCHAAAKLVSEAFDREIVIRDRHRFHHFKHGSCSCMDYW 780 >ref|XP_013648524.1| PREDICTED: pentatricopeptide repeat-containing protein At3g62890-like [Brassica napus] Length = 566 Score = 82.8 bits (203), Expect = 9e-14 Identities = 34/43 (79%), Positives = 36/43 (83%) Frame = -1 Query: 255 RICGDCHAAAKLISKLYKREIVLRDCYRFHHFKGGSCSCMDYW 127 RICGDCH KLISKLY REIV+RDC RFHHF+ GSCSC DYW Sbjct: 524 RICGDCHLVMKLISKLYGREIVVRDCNRFHHFRNGSCSCRDYW 566