BLASTX nr result
ID: Gardenia21_contig00040300
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00040300 (598 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP05410.1| unnamed protein product [Coffea canephora] 46 1e-09 >emb|CDP05410.1| unnamed protein product [Coffea canephora] Length = 112 Score = 46.2 bits (108), Expect(2) = 1e-09 Identities = 21/32 (65%), Positives = 24/32 (75%), Gaps = 2/32 (6%) Frame = -2 Query: 594 DLHYACWGDVLPIWRQRSEASLQ*WLH--VLF 505 DLHY+ WG V PIW + SEAS+Q WLH VLF Sbjct: 44 DLHYSLWGPVFPIWPKTSEASVQRWLHKYVLF 75 Score = 43.5 bits (101), Expect(2) = 1e-09 Identities = 19/27 (70%), Positives = 21/27 (77%) Frame = -3 Query: 500 NDAEVQ*INHLLSNCFVNLQPYMTPNY 420 +D EVQ I+HLLSNC V LQPY PNY Sbjct: 86 DDTEVQLIDHLLSNCLVTLQPYHDPNY 112