BLASTX nr result
ID: Gardenia21_contig00039698
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00039698 (331 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP03937.1| unnamed protein product [Coffea canephora] 109 9e-22 ref|XP_007201182.1| hypothetical protein PRUPE_ppa003350mg [Prun... 57 4e-06 >emb|CDP03937.1| unnamed protein product [Coffea canephora] Length = 508 Score = 109 bits (272), Expect = 9e-22 Identities = 49/54 (90%), Positives = 50/54 (92%) Frame = -2 Query: 162 MDKEYFLNAAGIQPPLQFEAWNSFSPAPELNCSSGEASNCFLNPNWDKPADHHA 1 MDKEYFLNAAG Q PLQFEAWNSFSPAPELNCSSGEASNC LNPNWDKPA H+A Sbjct: 1 MDKEYFLNAAGTQLPLQFEAWNSFSPAPELNCSSGEASNCCLNPNWDKPAGHYA 54 >ref|XP_007201182.1| hypothetical protein PRUPE_ppa003350mg [Prunus persica] gi|462396582|gb|EMJ02381.1| hypothetical protein PRUPE_ppa003350mg [Prunus persica] Length = 583 Score = 57.4 bits (137), Expect = 4e-06 Identities = 33/68 (48%), Positives = 42/68 (61%), Gaps = 15/68 (22%) Frame = -2 Query: 162 MDKEYFLNAAGIQPPLQFE------AW-NSFSPAPEL--------NCSSGEASNCFLNPN 28 M+ E+FLNA GI PPL FE AW +SFS A ++ NCSS ++ +CF NPN Sbjct: 1 MENEFFLNA-GIPPPLHFEQTSSMPAWRSSFSTAMDIQATATADRNCSSEQSPDCFYNPN 59 Query: 27 WDKPADHH 4 WDK AD + Sbjct: 60 WDKSADQN 67