BLASTX nr result
ID: Gardenia21_contig00037171
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00037171 (383 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP07590.1| unnamed protein product [Coffea canephora] 74 3e-11 >emb|CDP07590.1| unnamed protein product [Coffea canephora] Length = 78 Score = 74.3 bits (181), Expect = 3e-11 Identities = 39/50 (78%), Positives = 41/50 (82%) Frame = -1 Query: 284 MSSVVSKKHPNSSEPEKNAEHQEEISHQPSRGVTTHLYLKPAAQSAGTLD 135 MSSVVSKKH N SEPEKNAE EE +HQPSR VT+HL LKP A SAGTLD Sbjct: 1 MSSVVSKKHSNPSEPEKNAEDLEESNHQPSRAVTSHLQLKP-AHSAGTLD 49