BLASTX nr result
ID: Gardenia21_contig00034847
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00034847 (443 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP17920.1| unnamed protein product [Coffea canephora] 102 1e-19 emb|CDP08020.1| unnamed protein product [Coffea canephora] 96 1e-17 emb|CDP08019.1| unnamed protein product [Coffea canephora] 93 9e-17 emb|CDP11157.1| unnamed protein product [Coffea canephora] 92 2e-16 emb|CDP08021.1| unnamed protein product [Coffea canephora] 90 8e-16 emb|CDP21300.1| unnamed protein product [Coffea canephora] 86 8e-15 emb|CDP11160.1| unnamed protein product [Coffea canephora] 85 2e-14 emb|CDP08023.1| unnamed protein product [Coffea canephora] 84 3e-14 emb|CDP11163.1| unnamed protein product [Coffea canephora] 82 2e-13 emb|CDP11161.1| unnamed protein product [Coffea canephora] 81 4e-13 emb|CDP08038.1| unnamed protein product [Coffea canephora] 79 2e-12 emb|CDP21728.1| unnamed protein product [Coffea canephora] 79 2e-12 emb|CDP08024.1| unnamed protein product [Coffea canephora] 77 7e-12 emb|CDP08040.1| unnamed protein product [Coffea canephora] 75 3e-11 emb|CDP19132.1| unnamed protein product [Coffea canephora] 67 7e-09 emb|CDP13141.1| unnamed protein product [Coffea canephora] 50 9e-08 ref|XP_010319247.1| PREDICTED: putative late blight resistance p... 62 2e-07 emb|CDP13440.1| unnamed protein product [Coffea canephora] 60 6e-07 emb|CDP00736.1| unnamed protein product [Coffea canephora] 60 8e-07 ref|XP_006346788.1| PREDICTED: putative late blight resistance p... 60 8e-07 >emb|CDP17920.1| unnamed protein product [Coffea canephora] Length = 1489 Score = 102 bits (254), Expect = 1e-19 Identities = 51/64 (79%), Positives = 56/64 (87%) Frame = -2 Query: 442 PKLERLVLQNCKDLEGIPEDFGKIGSLKKIEVHWCGESAEKSAIKIGEEAGDIKVPIRSS 263 PKLERLVLQNCKDLE IPEDFG IGSL+ IEVHWCG+SAE+SA +I E+ GDIKV IRSS Sbjct: 1426 PKLERLVLQNCKDLEEIPEDFGMIGSLRMIEVHWCGKSAEESAEQIKEDYGDIKVFIRSS 1485 Query: 262 NLTS 251 NL S Sbjct: 1486 NLRS 1489 >emb|CDP08020.1| unnamed protein product [Coffea canephora] Length = 1459 Score = 95.5 bits (236), Expect = 1e-17 Identities = 47/64 (73%), Positives = 53/64 (82%) Frame = -2 Query: 442 PKLERLVLQNCKDLEGIPEDFGKIGSLKKIEVHWCGESAEKSAIKIGEEAGDIKVPIRSS 263 PKLERL+LQNCKDLE IP +F I +L+ IEVHWC E AEKSAIKIGEE +IKV IRSS Sbjct: 1396 PKLERLILQNCKDLEEIPAEFANIYTLEMIEVHWCSELAEKSAIKIGEETEEIKVLIRSS 1455 Query: 262 NLTS 251 NL+S Sbjct: 1456 NLSS 1459 >emb|CDP08019.1| unnamed protein product [Coffea canephora] Length = 1758 Score = 92.8 bits (229), Expect = 9e-17 Identities = 45/64 (70%), Positives = 53/64 (82%) Frame = -2 Query: 442 PKLERLVLQNCKDLEGIPEDFGKIGSLKKIEVHWCGESAEKSAIKIGEEAGDIKVPIRSS 263 P+LERLVLQ+CKDLE IPED I SL+ IEVHWCG+S E+SAI+IG+ G+IKV IRSS Sbjct: 1695 PRLERLVLQHCKDLEKIPEDLSDITSLETIEVHWCGQSVEESAIEIGKATGEIKVLIRSS 1754 Query: 262 NLTS 251 NL S Sbjct: 1755 NLRS 1758 Score = 90.1 bits (222), Expect = 6e-16 Identities = 45/60 (75%), Positives = 49/60 (81%) Frame = -2 Query: 442 PKLERLVLQNCKDLEGIPEDFGKIGSLKKIEVHWCGESAEKSAIKIGEEAGDIKVPIRSS 263 PKLERLVLQNCKDLE IPEDFG I +L IEVHWCG SAE+SA KI EE GDI+V IR + Sbjct: 1252 PKLERLVLQNCKDLEEIPEDFGNIYTLGMIEVHWCGRSAEESAKKIEEEYGDIEVLIRKA 1311 >emb|CDP11157.1| unnamed protein product [Coffea canephora] Length = 886 Score = 91.7 bits (226), Expect = 2e-16 Identities = 44/57 (77%), Positives = 49/57 (85%) Frame = -2 Query: 442 PKLERLVLQNCKDLEGIPEDFGKIGSLKKIEVHWCGESAEKSAIKIGEEAGDIKVPI 272 PKLERLVLQNCKDLE IP+DF IG+LK IEVHWCG+SAE+SA +I EE GDIKV I Sbjct: 811 PKLERLVLQNCKDLEEIPDDFAAIGTLKLIEVHWCGQSAEESAKRIREETGDIKVLI 867 >emb|CDP08021.1| unnamed protein product [Coffea canephora] Length = 854 Score = 89.7 bits (221), Expect = 8e-16 Identities = 44/64 (68%), Positives = 51/64 (79%) Frame = -2 Query: 442 PKLERLVLQNCKDLEGIPEDFGKIGSLKKIEVHWCGESAEKSAIKIGEEAGDIKVPIRSS 263 PKLERLVL+NCK LE IPED I SL+ IEVHWCG+S E+SAI+I + GDIKV I SS Sbjct: 791 PKLERLVLRNCKGLEKIPEDLSNIASLETIEVHWCGQSVEESAIEIRKTTGDIKVLITSS 850 Query: 262 NLTS 251 NL+S Sbjct: 851 NLSS 854 >emb|CDP21300.1| unnamed protein product [Coffea canephora] Length = 1433 Score = 86.3 bits (212), Expect = 8e-15 Identities = 42/59 (71%), Positives = 47/59 (79%) Frame = -2 Query: 442 PKLERLVLQNCKDLEGIPEDFGKIGSLKKIEVHWCGESAEKSAIKIGEEAGDIKVPIRS 266 PKLERLVLQNCKDLE +P DF IG+LK IEVHWCG+SAE+SA I E GDI+V I S Sbjct: 1372 PKLERLVLQNCKDLEEVPNDFADIGTLKVIEVHWCGQSAEESAKGIREAVGDIEVIISS 1430 >emb|CDP11160.1| unnamed protein product [Coffea canephora] Length = 1430 Score = 85.1 bits (209), Expect = 2e-14 Identities = 43/60 (71%), Positives = 47/60 (78%) Frame = -2 Query: 442 PKLERLVLQNCKDLEGIPEDFGKIGSLKKIEVHWCGESAEKSAIKIGEEAGDIKVPIRSS 263 PKLERLVLQNCKDLE IP DF IG+L+ IEVHWC +SAE+SA I E GDIKV I SS Sbjct: 1368 PKLERLVLQNCKDLEEIPNDFADIGTLELIEVHWCRQSAEESAKGIREATGDIKVLISSS 1427 >emb|CDP08023.1| unnamed protein product [Coffea canephora] Length = 1489 Score = 84.3 bits (207), Expect = 3e-14 Identities = 39/60 (65%), Positives = 50/60 (83%) Frame = -2 Query: 442 PKLERLVLQNCKDLEGIPEDFGKIGSLKKIEVHWCGESAEKSAIKIGEEAGDIKVPIRSS 263 P+L+RLV+QNCK+L+ +P+D I SL+ IEVHWCG+SAE+SA I EEAG+IKV IRSS Sbjct: 1426 PRLQRLVIQNCKELKELPDDLANITSLETIEVHWCGQSAEESANNIREEAGEIKVVIRSS 1485 >emb|CDP11163.1| unnamed protein product [Coffea canephora] Length = 2495 Score = 82.0 bits (201), Expect = 2e-13 Identities = 40/54 (74%), Positives = 44/54 (81%) Frame = -2 Query: 442 PKLERLVLQNCKDLEGIPEDFGKIGSLKKIEVHWCGESAEKSAIKIGEEAGDIK 281 PKLERLVLQNCKDL IP DF I +L+ IEVHWCGESAE+SA +IGE GDIK Sbjct: 1329 PKLERLVLQNCKDLMQIPYDFESITTLEVIEVHWCGESAEESAKEIGEATGDIK 1382 >emb|CDP11161.1| unnamed protein product [Coffea canephora] Length = 871 Score = 80.9 bits (198), Expect = 4e-13 Identities = 41/64 (64%), Positives = 46/64 (71%) Frame = -2 Query: 442 PKLERLVLQNCKDLEGIPEDFGKIGSLKKIEVHWCGESAEKSAIKIGEEAGDIKVPIRSS 263 PKLERLVLQNCK LE IP DF IG+L+ IEVHWC +S E+SA +I E GD KV I S Sbjct: 806 PKLERLVLQNCKGLEEIPYDFADIGTLEVIEVHWCRQSVEESAQRIAEATGDTKVLISGS 865 Query: 262 NLTS 251 L S Sbjct: 866 YLRS 869 >emb|CDP08038.1| unnamed protein product [Coffea canephora] Length = 1468 Score = 78.6 bits (192), Expect = 2e-12 Identities = 39/64 (60%), Positives = 51/64 (79%) Frame = -2 Query: 442 PKLERLVLQNCKDLEGIPEDFGKIGSLKKIEVHWCGESAEKSAIKIGEEAGDIKVPIRSS 263 P+LERLVLQNC DLE IP D +I SL+ IEV++C +S E+SA +IGE G++KV IRSS Sbjct: 1405 PRLERLVLQNCNDLEEIPLDLAEILSLQMIEVNFCAQSVEESAKEIGEATGEVKVLIRSS 1464 Query: 262 NLTS 251 +LT+ Sbjct: 1465 DLTT 1468 >emb|CDP21728.1| unnamed protein product [Coffea canephora] Length = 705 Score = 78.6 bits (192), Expect = 2e-12 Identities = 39/64 (60%), Positives = 46/64 (71%) Frame = -2 Query: 442 PKLERLVLQNCKDLEGIPEDFGKIGSLKKIEVHWCGESAEKSAIKIGEEAGDIKVPIRSS 263 PKLE LVLQNCKDLE IP DF IG+L+ IE HWC ++ E+SA +I E GD KV I SS Sbjct: 640 PKLEWLVLQNCKDLEEIPYDFADIGTLEVIEAHWCRQTVEESAQRIAEATGDTKVLISSS 699 Query: 262 NLTS 251 + S Sbjct: 700 YMRS 703 >emb|CDP08024.1| unnamed protein product [Coffea canephora] Length = 703 Score = 76.6 bits (187), Expect = 7e-12 Identities = 39/64 (60%), Positives = 49/64 (76%) Frame = -2 Query: 442 PKLERLVLQNCKDLEGIPEDFGKIGSLKKIEVHWCGESAEKSAIKIGEEAGDIKVPIRSS 263 P+LERLVLQNC DLE IP D I SL+ IEV+ C +S E+SA +IGE G++KV IRSS Sbjct: 640 PRLERLVLQNCNDLEEIPFDLADILSLQMIEVNCCAQSVEESAKEIGEATGEVKVLIRSS 699 Query: 262 NLTS 251 +LT+ Sbjct: 700 DLTT 703 >emb|CDP08040.1| unnamed protein product [Coffea canephora] Length = 576 Score = 74.7 bits (182), Expect = 3e-11 Identities = 38/64 (59%), Positives = 50/64 (78%) Frame = -2 Query: 442 PKLERLVLQNCKDLEGIPEDFGKIGSLKKIEVHWCGESAEKSAIKIGEEAGDIKVPIRSS 263 P+LERLVLQNC DLE IP D I SL+ IEV+ C +S E+SA +IG+ +G++KV IRSS Sbjct: 513 PRLERLVLQNCNDLEEIPFDLVDILSLQMIEVNCCAQSVEESAKEIGDASGEVKVLIRSS 572 Query: 262 NLTS 251 +LT+ Sbjct: 573 DLTT 576 >emb|CDP19132.1| unnamed protein product [Coffea canephora] Length = 1249 Score = 66.6 bits (161), Expect = 7e-09 Identities = 35/57 (61%), Positives = 38/57 (66%) Frame = -2 Query: 442 PKLERLVLQNCKDLEGIPEDFGKIGSLKKIEVHWCGESAEKSAIKIGEEAGDIKVPI 272 P LE+LVLQ CK LE IP FG I +L+KIEV WC SA KSA I E DIKV I Sbjct: 1183 PCLEQLVLQKCKQLEEIPSSFGDIATLEKIEVQWCSISASKSATDIEAEEPDIKVLI 1239 >emb|CDP13141.1| unnamed protein product [Coffea canephora] Length = 692 Score = 50.4 bits (119), Expect(2) = 9e-08 Identities = 23/33 (69%), Positives = 27/33 (81%) Frame = -2 Query: 442 PKLERLVLQNCKDLEGIPEDFGKIGSLKKIEVH 344 PKLERL+LQNCKDLE IP +F I +L+ IEVH Sbjct: 619 PKLERLILQNCKDLEEIPAEFADIYTLEMIEVH 651 Score = 32.3 bits (72), Expect(2) = 9e-08 Identities = 12/19 (63%), Positives = 15/19 (78%) Frame = -1 Query: 278 PYQEFKFDFMSAIWYVCLM 222 PYQEF+F+FMS IW L+ Sbjct: 653 PYQEFEFEFMSTIWITLLV 671 >ref|XP_010319247.1| PREDICTED: putative late blight resistance protein homolog R1A-10 [Solanum lycopersicum] Length = 895 Score = 62.0 bits (149), Expect = 2e-07 Identities = 30/53 (56%), Positives = 41/53 (77%) Frame = -2 Query: 442 PKLERLVLQNCKDLEGIPEDFGKIGSLKKIEVHWCGESAEKSAIKIGEEAGDI 284 PKL+RLVL+NC DL+GIP DFG+I SL+ IE++ C +AE SA +I +E D+ Sbjct: 813 PKLKRLVLKNCGDLQGIPADFGEICSLESIELYDCSTTAENSAREIVQEQEDM 865 >emb|CDP13440.1| unnamed protein product [Coffea canephora] Length = 735 Score = 60.1 bits (144), Expect = 6e-07 Identities = 28/49 (57%), Positives = 36/49 (73%) Frame = -2 Query: 442 PKLERLVLQNCKDLEGIPEDFGKIGSLKKIEVHWCGESAEKSAIKIGEE 296 P LE L L+NCKDLE +P +F I +L+KIEV +CG+S E+S KI EE Sbjct: 677 PNLEHLALRNCKDLEEVPFEFADIPNLQKIEVQFCGQSTEESVRKIEEE 725 >emb|CDP00736.1| unnamed protein product [Coffea canephora] Length = 822 Score = 59.7 bits (143), Expect = 8e-07 Identities = 30/59 (50%), Positives = 43/59 (72%) Frame = -2 Query: 442 PKLERLVLQNCKDLEGIPEDFGKIGSLKKIEVHWCGESAEKSAIKIGEEAGDIKVPIRS 266 P L+RLVL NC+ LE IP + G+I +L+ +E+H C +SAE SA +IGE+ ++V IRS Sbjct: 762 PSLDRLVLVNCRFLEEIPVEIGEIPTLRLLELHNCSKSAEISAKEIGEQVEGLQVIIRS 820 >ref|XP_006346788.1| PREDICTED: putative late blight resistance protein homolog R1B-16-like [Solanum tuberosum] Length = 676 Score = 59.7 bits (143), Expect = 8e-07 Identities = 28/53 (52%), Positives = 39/53 (73%) Frame = -2 Query: 442 PKLERLVLQNCKDLEGIPEDFGKIGSLKKIEVHWCGESAEKSAIKIGEEAGDI 284 P L+RLVL+NC DL+ IP DFG+IG+L+ IE+H C + E SA +I +E D+ Sbjct: 609 PNLKRLVLKNCTDLQEIPGDFGEIGTLESIELHDCSTTTEDSAREIVQEQEDM 661