BLASTX nr result
ID: Gardenia21_contig00034473
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00034473 (287 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP03649.1| unnamed protein product [Coffea canephora] 77 5e-18 ref|XP_014495249.1| PREDICTED: tRNA (guanine-N(7)-)-methyltransf... 71 8e-15 ref|XP_009370801.1| PREDICTED: tRNA (guanine-N(7)-)-methyltransf... 70 1e-14 ref|XP_010256096.1| PREDICTED: tRNA (guanine-N(7)-)-methyltransf... 67 1e-14 ref|XP_012435847.1| PREDICTED: tRNA (guanine-N(7)-)-methyltransf... 69 1e-14 ref|XP_002524762.1| WD-repeat protein, putative [Ricinus communi... 67 1e-14 ref|XP_010086614.1| tRNA (guanine-N(7)-)-methyltransferase subun... 69 1e-14 ref|XP_009367616.1| PREDICTED: LOW QUALITY PROTEIN: tRNA (guanin... 67 2e-14 ref|XP_003553467.2| PREDICTED: tRNA (guanine-N(7)-)-methyltransf... 66 3e-14 gb|KRG95555.1| hypothetical protein GLYMA_19G158200 [Glycine max] 66 3e-14 gb|KHN02566.1| tRNA (guanine-N(7)-)-methyltransferase subunit WD... 66 3e-14 gb|KMZ56427.1| tRNA (Guanine-N(7)-)-methyltransferase subunit TR... 65 4e-14 gb|KDO68684.1| hypothetical protein CISIN_1g013631mg [Citrus sin... 66 4e-14 ref|XP_006479695.1| PREDICTED: tRNA (guanine-N(7)-)-methyltransf... 66 4e-14 ref|XP_003632308.1| PREDICTED: tRNA (guanine-N(7)-)-methyltransf... 70 4e-14 ref|XP_006444039.1| hypothetical protein CICLE_v10020269mg [Citr... 66 4e-14 ref|XP_013449757.1| tRNA (guanine-N(7))-methyltransferase subuni... 66 5e-14 ref|XP_013449758.1| tRNA (guanine-N(7))-methyltransferase subuni... 66 5e-14 ref|XP_007050554.1| Transducin/WD40 repeat-like superfamily prot... 64 7e-14 ref|XP_008386471.1| PREDICTED: tRNA (guanine-N(7)-)-methyltransf... 65 9e-14 >emb|CDP03649.1| unnamed protein product [Coffea canephora] Length = 442 Score = 77.4 bits (189), Expect(2) = 5e-18 Identities = 35/39 (89%), Positives = 36/39 (92%) Frame = -3 Query: 117 QVSVFPKNPLDGAHEIQSFCLGHTEFVSCPAFVFSQDCP 1 +VSVFPKNPLDGAHEIQSFCLGHTEFVSC AFVF QD P Sbjct: 186 RVSVFPKNPLDGAHEIQSFCLGHTEFVSCLAFVFGQDYP 224 Score = 40.0 bits (92), Expect(2) = 5e-18 Identities = 18/24 (75%), Positives = 22/24 (91%) Frame = -1 Query: 287 SPDSRFIISADRDFKIRVTLLSQH 216 SPDSRFIISADRDFKIRV++ ++ Sbjct: 170 SPDSRFIISADRDFKIRVSVFPKN 193 >ref|XP_014495249.1| PREDICTED: tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit wdr4 isoform X1 [Vigna radiata var. radiata] gi|950949846|ref|XP_014495250.1| PREDICTED: tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit wdr4 isoform X2 [Vigna radiata var. radiata] Length = 416 Score = 70.9 bits (172), Expect(2) = 8e-15 Identities = 30/39 (76%), Positives = 36/39 (92%) Frame = -3 Query: 117 QVSVFPKNPLDGAHEIQSFCLGHTEFVSCPAFVFSQDCP 1 +V+ FPKNPL+GAH+IQSFCLGHTEFVSC AFV +Q+CP Sbjct: 169 RVTCFPKNPLNGAHQIQSFCLGHTEFVSCLAFVQAQECP 207 Score = 35.8 bits (81), Expect(2) = 8e-15 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = -1 Query: 287 SPDSRFIISADRDFKIRVT 231 SP RFI+SADRDFKIRVT Sbjct: 153 SPHGRFILSADRDFKIRVT 171 >ref|XP_009370801.1| PREDICTED: tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit wdr4-like [Pyrus x bretschneideri] Length = 432 Score = 70.1 bits (170), Expect(2) = 1e-14 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = -3 Query: 117 QVSVFPKNPLDGAHEIQSFCLGHTEFVSCPAFVFSQDCP 1 +V+VFPK PLDGAHEIQSF LGHTEFVSC AFV +Q+CP Sbjct: 179 RVTVFPKKPLDGAHEIQSFSLGHTEFVSCLAFVCTQECP 217 Score = 36.2 bits (82), Expect(2) = 1e-14 Identities = 15/20 (75%), Positives = 18/20 (90%) Frame = -1 Query: 287 SPDSRFIISADRDFKIRVTL 228 SPD +F +SADRDFKIRVT+ Sbjct: 163 SPDGQFFVSADRDFKIRVTV 182 >ref|XP_010256096.1| PREDICTED: tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit wdr4 [Nelumbo nucifera] gi|720000659|ref|XP_010256097.1| PREDICTED: tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit wdr4 [Nelumbo nucifera] Length = 432 Score = 67.4 bits (163), Expect(2) = 1e-14 Identities = 30/39 (76%), Positives = 34/39 (87%) Frame = -3 Query: 117 QVSVFPKNPLDGAHEIQSFCLGHTEFVSCPAFVFSQDCP 1 +V++FPK PL+GAHEIQSFCLGHTEFVSC AFV S D P Sbjct: 179 RVTLFPKKPLNGAHEIQSFCLGHTEFVSCLAFVCSSDYP 217 Score = 38.9 bits (89), Expect(2) = 1e-14 Identities = 17/20 (85%), Positives = 19/20 (95%) Frame = -1 Query: 287 SPDSRFIISADRDFKIRVTL 228 SPD +FI+SADRDFKIRVTL Sbjct: 163 SPDGQFIVSADRDFKIRVTL 182 >ref|XP_012435847.1| PREDICTED: tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit wdr4 [Gossypium raimondii] gi|763779893|gb|KJB46964.1| hypothetical protein B456_008G003800 [Gossypium raimondii] Length = 452 Score = 68.6 bits (166), Expect(2) = 1e-14 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = -3 Query: 117 QVSVFPKNPLDGAHEIQSFCLGHTEFVSCPAFVFSQDCP 1 +V+VFPK PLDGAHE+QSFCLGHTEFVSC AF+ + D P Sbjct: 200 RVTVFPKKPLDGAHEVQSFCLGHTEFVSCLAFICTPDSP 238 Score = 37.4 bits (85), Expect(2) = 1e-14 Identities = 16/20 (80%), Positives = 18/20 (90%) Frame = -1 Query: 287 SPDSRFIISADRDFKIRVTL 228 SPD FI+SADRDFKIRVT+ Sbjct: 184 SPDGHFIVSADRDFKIRVTV 203 >ref|XP_002524762.1| WD-repeat protein, putative [Ricinus communis] gi|223535946|gb|EEF37605.1| WD-repeat protein, putative [Ricinus communis] Length = 435 Score = 66.6 bits (161), Expect(2) = 1e-14 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = -3 Query: 117 QVSVFPKNPLDGAHEIQSFCLGHTEFVSCPAFVFSQDCP 1 +V+VFPK LDGAHEIQSFCLGHTEFVSC AF+++ D P Sbjct: 182 RVTVFPKKTLDGAHEIQSFCLGHTEFVSCLAFIWAADYP 220 Score = 39.3 bits (90), Expect(2) = 1e-14 Identities = 17/20 (85%), Positives = 19/20 (95%) Frame = -1 Query: 287 SPDSRFIISADRDFKIRVTL 228 SPD RFI+SADRDFKIRVT+ Sbjct: 166 SPDGRFIVSADRDFKIRVTV 185 >ref|XP_010086614.1| tRNA (guanine-N(7)-)-methyltransferase subunit [Morus notabilis] gi|587831227|gb|EXB22125.1| tRNA (guanine-N(7)-)-methyltransferase subunit [Morus notabilis] Length = 416 Score = 69.3 bits (168), Expect(2) = 1e-14 Identities = 29/39 (74%), Positives = 36/39 (92%) Frame = -3 Query: 117 QVSVFPKNPLDGAHEIQSFCLGHTEFVSCPAFVFSQDCP 1 + +VFPKNPLDGAHEIQSFCLGHTEFVSC AF+++++ P Sbjct: 179 RATVFPKNPLDGAHEIQSFCLGHTEFVSCLAFLWTEEYP 217 Score = 36.6 bits (83), Expect(2) = 1e-14 Identities = 15/24 (62%), Positives = 20/24 (83%) Frame = -1 Query: 287 SPDSRFIISADRDFKIRVTLLSQH 216 SPD +FI+SADRDFKIR T+ ++ Sbjct: 163 SPDGKFILSADRDFKIRATVFPKN 186 >ref|XP_009367616.1| PREDICTED: LOW QUALITY PROTEIN: tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit wdr4-like [Pyrus x bretschneideri] Length = 435 Score = 67.4 bits (163), Expect(2) = 2e-14 Identities = 30/38 (78%), Positives = 34/38 (89%) Frame = -3 Query: 117 QVSVFPKNPLDGAHEIQSFCLGHTEFVSCPAFVFSQDC 4 +V+VFPK PLDGAHEIQSF LGHTEFVSC AFV +Q+C Sbjct: 182 RVTVFPKKPLDGAHEIQSFSLGHTEFVSCLAFVCTQEC 219 Score = 37.7 bits (86), Expect(2) = 2e-14 Identities = 16/20 (80%), Positives = 18/20 (90%) Frame = -1 Query: 287 SPDSRFIISADRDFKIRVTL 228 SPD RF +SADRDFKIRVT+ Sbjct: 166 SPDGRFFVSADRDFKIRVTV 185 >ref|XP_003553467.2| PREDICTED: tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit wdr4-like [Glycine max] Length = 419 Score = 65.9 bits (159), Expect(2) = 3e-14 Identities = 27/39 (69%), Positives = 35/39 (89%) Frame = -3 Query: 117 QVSVFPKNPLDGAHEIQSFCLGHTEFVSCPAFVFSQDCP 1 +V+ FP+ PL+GAH+IQSFCLGHTEFVSC AF+ +Q+CP Sbjct: 171 RVTNFPQKPLNGAHQIQSFCLGHTEFVSCLAFIQAQECP 209 Score = 38.9 bits (89), Expect(2) = 3e-14 Identities = 18/23 (78%), Positives = 19/23 (82%) Frame = -1 Query: 287 SPDSRFIISADRDFKIRVTLLSQ 219 SPD RFI+SADRDFKIRVT Q Sbjct: 155 SPDGRFILSADRDFKIRVTNFPQ 177 >gb|KRG95555.1| hypothetical protein GLYMA_19G158200 [Glycine max] Length = 417 Score = 65.9 bits (159), Expect(2) = 3e-14 Identities = 27/39 (69%), Positives = 35/39 (89%) Frame = -3 Query: 117 QVSVFPKNPLDGAHEIQSFCLGHTEFVSCPAFVFSQDCP 1 +V+ FP+ PL+GAH+IQSFCLGHTEFVSC AF+ +Q+CP Sbjct: 169 RVTNFPQKPLNGAHQIQSFCLGHTEFVSCLAFIQAQECP 207 Score = 38.9 bits (89), Expect(2) = 3e-14 Identities = 18/23 (78%), Positives = 19/23 (82%) Frame = -1 Query: 287 SPDSRFIISADRDFKIRVTLLSQ 219 SPD RFI+SADRDFKIRVT Q Sbjct: 153 SPDGRFILSADRDFKIRVTNFPQ 175 >gb|KHN02566.1| tRNA (guanine-N(7)-)-methyltransferase subunit WDR4 [Glycine soja] Length = 356 Score = 65.9 bits (159), Expect(2) = 3e-14 Identities = 27/39 (69%), Positives = 35/39 (89%) Frame = -3 Query: 117 QVSVFPKNPLDGAHEIQSFCLGHTEFVSCPAFVFSQDCP 1 +V+ FP+ PL+GAH+IQSFCLGHTEFVSC AF+ +Q+CP Sbjct: 108 RVTNFPQKPLNGAHQIQSFCLGHTEFVSCLAFIQAQECP 146 Score = 38.9 bits (89), Expect(2) = 3e-14 Identities = 18/23 (78%), Positives = 19/23 (82%) Frame = -1 Query: 287 SPDSRFIISADRDFKIRVTLLSQ 219 SPD RFI+SADRDFKIRVT Q Sbjct: 92 SPDGRFILSADRDFKIRVTNFPQ 114 >gb|KMZ56427.1| tRNA (Guanine-N(7)-)-methyltransferase subunit TRM82 [Zostera marina] Length = 447 Score = 65.5 bits (158), Expect(2) = 4e-14 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = -3 Query: 117 QVSVFPKNPLDGAHEIQSFCLGHTEFVSCPAFVFSQD 7 +++VFPK PL GAHEIQSFCLGHT+FVSC AF FS D Sbjct: 185 RITVFPKKPLKGAHEIQSFCLGHTDFVSCLAFAFSTD 221 Score = 38.9 bits (89), Expect(2) = 4e-14 Identities = 16/20 (80%), Positives = 19/20 (95%) Frame = -1 Query: 287 SPDSRFIISADRDFKIRVTL 228 SPD RFI+SADRDFKIR+T+ Sbjct: 169 SPDGRFIVSADRDFKIRITV 188 >gb|KDO68684.1| hypothetical protein CISIN_1g013631mg [Citrus sinensis] Length = 439 Score = 66.2 bits (160), Expect(2) = 4e-14 Identities = 30/39 (76%), Positives = 33/39 (84%) Frame = -3 Query: 117 QVSVFPKNPLDGAHEIQSFCLGHTEFVSCPAFVFSQDCP 1 +V+VFPK PLDGAHEIQSFCLGHTEFVSC FV + D P Sbjct: 187 RVTVFPKGPLDGAHEIQSFCLGHTEFVSCLDFVCTVDYP 225 Score = 38.1 bits (87), Expect(2) = 4e-14 Identities = 17/20 (85%), Positives = 19/20 (95%) Frame = -1 Query: 287 SPDSRFIISADRDFKIRVTL 228 SPD +FIISADRDFKIRVT+ Sbjct: 171 SPDGQFIISADRDFKIRVTV 190 >ref|XP_006479695.1| PREDICTED: tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit wdr4-like [Citrus sinensis] Length = 439 Score = 66.2 bits (160), Expect(2) = 4e-14 Identities = 30/39 (76%), Positives = 33/39 (84%) Frame = -3 Query: 117 QVSVFPKNPLDGAHEIQSFCLGHTEFVSCPAFVFSQDCP 1 +V+VFPK PLDGAHEIQSFCLGHTEFVSC FV + D P Sbjct: 187 RVTVFPKGPLDGAHEIQSFCLGHTEFVSCLDFVCTVDYP 225 Score = 38.1 bits (87), Expect(2) = 4e-14 Identities = 17/20 (85%), Positives = 19/20 (95%) Frame = -1 Query: 287 SPDSRFIISADRDFKIRVTL 228 SPD +FIISADRDFKIRVT+ Sbjct: 171 SPDGQFIISADRDFKIRVTV 190 >ref|XP_003632308.1| PREDICTED: tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit wdr4 [Vitis vinifera] gi|296085216|emb|CBI28711.3| unnamed protein product [Vitis vinifera] Length = 433 Score = 70.1 bits (170), Expect(2) = 4e-14 Identities = 32/39 (82%), Positives = 34/39 (87%) Frame = -3 Query: 117 QVSVFPKNPLDGAHEIQSFCLGHTEFVSCPAFVFSQDCP 1 +VSVFPK PLDGAHEIQSFCLGHTEFVSC AFV + D P Sbjct: 179 RVSVFPKKPLDGAHEIQSFCLGHTEFVSCLAFVCAPDYP 217 Score = 34.3 bits (77), Expect(2) = 4e-14 Identities = 16/20 (80%), Positives = 18/20 (90%) Frame = -1 Query: 287 SPDSRFIISADRDFKIRVTL 228 S D RFIISADRDFKIRV++ Sbjct: 163 SLDGRFIISADRDFKIRVSV 182 >ref|XP_006444039.1| hypothetical protein CICLE_v10020269mg [Citrus clementina] gi|557546301|gb|ESR57279.1| hypothetical protein CICLE_v10020269mg [Citrus clementina] Length = 426 Score = 66.2 bits (160), Expect(2) = 4e-14 Identities = 30/39 (76%), Positives = 33/39 (84%) Frame = -3 Query: 117 QVSVFPKNPLDGAHEIQSFCLGHTEFVSCPAFVFSQDCP 1 +V+VFPK PLDGAHEIQSFCLGHTEFVSC FV + D P Sbjct: 174 RVTVFPKGPLDGAHEIQSFCLGHTEFVSCLDFVCTVDYP 212 Score = 38.1 bits (87), Expect(2) = 4e-14 Identities = 17/20 (85%), Positives = 19/20 (95%) Frame = -1 Query: 287 SPDSRFIISADRDFKIRVTL 228 SPD +FIISADRDFKIRVT+ Sbjct: 158 SPDGQFIISADRDFKIRVTV 177 >ref|XP_013449757.1| tRNA (guanine-N(7))-methyltransferase subunit WDR4 [Medicago truncatula] gi|657379405|gb|KEH23785.1| tRNA (guanine-N(7))-methyltransferase subunit WDR4 [Medicago truncatula] Length = 423 Score = 66.2 bits (160), Expect(2) = 5e-14 Identities = 30/39 (76%), Positives = 35/39 (89%) Frame = -3 Query: 117 QVSVFPKNPLDGAHEIQSFCLGHTEFVSCPAFVFSQDCP 1 +V+ FPKNPL+GAHEIQSFCLGHTEFVSC AFV +Q+ P Sbjct: 175 RVTNFPKNPLNGAHEIQSFCLGHTEFVSCLAFVPAQENP 213 Score = 37.7 bits (86), Expect(2) = 5e-14 Identities = 16/19 (84%), Positives = 19/19 (100%) Frame = -1 Query: 287 SPDSRFIISADRDFKIRVT 231 SPD+R+I+SADRDFKIRVT Sbjct: 159 SPDNRYILSADRDFKIRVT 177 >ref|XP_013449758.1| tRNA (guanine-N(7))-methyltransferase subunit WDR4 [Medicago truncatula] gi|657379406|gb|KEH23786.1| tRNA (guanine-N(7))-methyltransferase subunit WDR4 [Medicago truncatula] Length = 308 Score = 66.2 bits (160), Expect(2) = 5e-14 Identities = 30/39 (76%), Positives = 35/39 (89%) Frame = -3 Query: 117 QVSVFPKNPLDGAHEIQSFCLGHTEFVSCPAFVFSQDCP 1 +V+ FPKNPL+GAHEIQSFCLGHTEFVSC AFV +Q+ P Sbjct: 175 RVTNFPKNPLNGAHEIQSFCLGHTEFVSCLAFVPAQENP 213 Score = 37.7 bits (86), Expect(2) = 5e-14 Identities = 16/19 (84%), Positives = 19/19 (100%) Frame = -1 Query: 287 SPDSRFIISADRDFKIRVT 231 SPD+R+I+SADRDFKIRVT Sbjct: 159 SPDNRYILSADRDFKIRVT 177 >ref|XP_007050554.1| Transducin/WD40 repeat-like superfamily protein, putative isoform 1 [Theobroma cacao] gi|508702815|gb|EOX94711.1| Transducin/WD40 repeat-like superfamily protein, putative isoform 1 [Theobroma cacao] Length = 449 Score = 64.3 bits (155), Expect(2) = 7e-14 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = -3 Query: 117 QVSVFPKNPLDGAHEIQSFCLGHTEFVSCPAFVFSQD 7 +V+VFPK PLDGAHEIQSFCLGH EFVSC AF+ + D Sbjct: 197 RVTVFPKKPLDGAHEIQSFCLGHKEFVSCLAFICTPD 233 Score = 39.3 bits (90), Expect(2) = 7e-14 Identities = 17/20 (85%), Positives = 19/20 (95%) Frame = -1 Query: 287 SPDSRFIISADRDFKIRVTL 228 SPD RFI+SADRDFKIRVT+ Sbjct: 181 SPDGRFIVSADRDFKIRVTV 200 >ref|XP_008386471.1| PREDICTED: tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit wdr4 [Malus domestica] Length = 432 Score = 65.5 bits (158), Expect(2) = 9e-14 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = -3 Query: 117 QVSVFPKNPLDGAHEIQSFCLGHTEFVSCPAFVFSQDC 4 +V+VFP PLDGAHEIQSF LGHTEFVSC AFV +Q+C Sbjct: 179 RVTVFPNKPLDGAHEIQSFSLGHTEFVSCLAFVCTQEC 216 Score = 37.7 bits (86), Expect(2) = 9e-14 Identities = 16/20 (80%), Positives = 18/20 (90%) Frame = -1 Query: 287 SPDSRFIISADRDFKIRVTL 228 SPD RF +SADRDFKIRVT+ Sbjct: 163 SPDGRFFVSADRDFKIRVTV 182