BLASTX nr result
ID: Gardenia21_contig00034438
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00034438 (235 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP17986.1| unnamed protein product [Coffea canephora] 63 1e-14 >emb|CDP17986.1| unnamed protein product [Coffea canephora] Length = 216 Score = 63.2 bits (152), Expect(2) = 1e-14 Identities = 32/49 (65%), Positives = 36/49 (73%) Frame = +2 Query: 86 ALPDSQTAPKDYYNDEDELFFERKYH*ILENEIGIGCMLLKPLASPTKN 232 AL DSQ A DY N E+ L FER H I ENEIG+GC+LL+P ASPTKN Sbjct: 163 ALQDSQAAAGDYCNGEEVLIFERINHYIPENEIGLGCILLQPPASPTKN 211 Score = 42.7 bits (99), Expect(2) = 1e-14 Identities = 19/25 (76%), Positives = 22/25 (88%) Frame = +1 Query: 7 NVLKRKRSIRDQYVMSPSERLHQQL 81 NV KRKRSI DQ++MSP+E LHQQL Sbjct: 136 NVFKRKRSILDQHIMSPTEMLHQQL 160