BLASTX nr result
ID: Gardenia21_contig00034357
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00034357 (621 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP02274.1| unnamed protein product [Coffea canephora] 136 8e-30 >emb|CDP02274.1| unnamed protein product [Coffea canephora] Length = 957 Score = 136 bits (343), Expect = 8e-30 Identities = 63/66 (95%), Positives = 64/66 (96%) Frame = -2 Query: 200 MGTQILHSKRYSTGYCSIWGPNAIVSNDIWSVYHEDKAPKNGQYGDSLLSGQVTVNGSIE 21 MGTQILHSKRYSTGYCSIWGPNAIVSNDIWSVYHEDKAPKNGQ+GD LL GQVTVNGSIE Sbjct: 1 MGTQILHSKRYSTGYCSIWGPNAIVSNDIWSVYHEDKAPKNGQFGDFLLPGQVTVNGSIE 60 Query: 20 YNKEKV 3 YNKEKV Sbjct: 61 YNKEKV 66