BLASTX nr result
ID: Gardenia21_contig00034328
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00034328 (213 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP03527.1| unnamed protein product [Coffea canephora] 115 1e-23 >emb|CDP03527.1| unnamed protein product [Coffea canephora] Length = 1683 Score = 115 bits (288), Expect = 1e-23 Identities = 59/70 (84%), Positives = 61/70 (87%) Frame = -2 Query: 212 EKSNRKLSLSEKVRESSKPTSADEKSVYQKKEVNHKEDMAECSIKTESNVSSEIKYPKVD 33 EKSNRKLSLSEKVRESSKPT DEKSV+QKKEVNHKED AE SIK ESNVS E KYPKVD Sbjct: 415 EKSNRKLSLSEKVRESSKPTYTDEKSVHQKKEVNHKEDKAEFSIKIESNVSGERKYPKVD 474 Query: 32 DPSKHDVDQK 3 D S H+VDQK Sbjct: 475 DSSNHNVDQK 484