BLASTX nr result
ID: Gardenia21_contig00034283
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00034283 (252 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010088916.1| hypothetical protein L484_018543 [Morus nota... 60 5e-07 >ref|XP_010088916.1| hypothetical protein L484_018543 [Morus notabilis] gi|587846655|gb|EXB37120.1| hypothetical protein L484_018543 [Morus notabilis] Length = 240 Score = 60.5 bits (145), Expect = 5e-07 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = +2 Query: 56 SSILFSSREVPDRRSIRNGRSVHFVGRKDPIHSG 157 SSILFSS+E+ DRRSIRNG VHFVGRKDPIHSG Sbjct: 195 SSILFSSQELLDRRSIRNGLRVHFVGRKDPIHSG 228