BLASTX nr result
ID: Gardenia21_contig00034195
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00034195 (229 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP03172.1| unnamed protein product [Coffea canephora] 59 1e-06 ref|XP_010262166.1| PREDICTED: thioredoxin-like 2, chloroplastic... 58 2e-06 ref|XP_009409351.1| PREDICTED: thioredoxin-like 2, chloroplastic... 58 2e-06 ref|XP_006858375.1| PREDICTED: thioredoxin-like 2, chloroplastic... 58 2e-06 ref|XP_011014007.1| PREDICTED: thioredoxin-like 2, chloroplastic... 58 3e-06 ref|XP_011013361.1| PREDICTED: thioredoxin-like 2, chloroplastic... 58 3e-06 gb|KHN32916.1| Thioredoxin-like 2, chloroplastic [Glycine soja] 58 3e-06 ref|XP_002514101.1| Thioredoxin, putative [Ricinus communis] gi|... 58 3e-06 ref|XP_003517423.1| PREDICTED: thioredoxin-like 2, chloroplastic... 58 3e-06 gb|ACU19208.1| unknown [Glycine max] 58 3e-06 ref|XP_002282326.1| PREDICTED: thioredoxin-like 2, chloroplastic... 58 3e-06 emb|CAN62376.1| hypothetical protein VITISV_000883 [Vitis vinifera] 58 3e-06 ref|XP_004513104.1| PREDICTED: thioredoxin-like 2, chloroplastic... 57 5e-06 ref|XP_003620940.1| thioredoxin [Medicago truncatula] gi|3554959... 57 5e-06 ref|XP_012076910.1| PREDICTED: thioredoxin-like 2, chloroplastic... 57 7e-06 gb|KHN40327.1| Thioredoxin-like 2, chloroplastic [Glycine soja] 57 7e-06 ref|XP_010523570.1| PREDICTED: thioredoxin-like 2-2, chloroplast... 57 7e-06 ref|XP_009361589.1| PREDICTED: thioredoxin-like 2, chloroplastic... 57 7e-06 ref|XP_009352642.1| PREDICTED: thioredoxin-like 2, chloroplastic... 57 7e-06 ref|XP_008437900.1| PREDICTED: thioredoxin-like 2, chloroplastic... 57 7e-06 >emb|CDP03172.1| unnamed protein product [Coffea canephora] Length = 232 Score = 59.3 bits (142), Expect = 1e-06 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = +1 Query: 136 RVVTSMLCRTAEEHPDILFLKVNFDENKPMC 228 R + LCRTAEEHPDILFLKVNFDENKPMC Sbjct: 128 RALFPKLCRTAEEHPDILFLKVNFDENKPMC 158 >ref|XP_010262166.1| PREDICTED: thioredoxin-like 2, chloroplastic [Nelumbo nucifera] Length = 229 Score = 58.2 bits (139), Expect = 2e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = +1 Query: 136 RVVTSMLCRTAEEHPDILFLKVNFDENKPMC 228 R + LC+TAEEHPDILFLKVNFDENKPMC Sbjct: 129 RALFPKLCKTAEEHPDILFLKVNFDENKPMC 159 >ref|XP_009409351.1| PREDICTED: thioredoxin-like 2, chloroplastic isoform X1 [Musa acuminata subsp. malaccensis] Length = 212 Score = 58.2 bits (139), Expect = 2e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = +1 Query: 136 RVVTSMLCRTAEEHPDILFLKVNFDENKPMC 228 R + LC+TAEEHPDILFLKVNFDENKPMC Sbjct: 117 RALFPKLCKTAEEHPDILFLKVNFDENKPMC 147 >ref|XP_006858375.1| PREDICTED: thioredoxin-like 2, chloroplastic [Amborella trichopoda] gi|548862482|gb|ERN19842.1| hypothetical protein AMTR_s00064p00202170 [Amborella trichopoda] Length = 227 Score = 58.2 bits (139), Expect = 2e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = +1 Query: 136 RVVTSMLCRTAEEHPDILFLKVNFDENKPMC 228 R + LC+TAEEHPDILFLKVNFDENKPMC Sbjct: 121 RALFPKLCKTAEEHPDILFLKVNFDENKPMC 151 >ref|XP_011014007.1| PREDICTED: thioredoxin-like 2, chloroplastic [Populus euphratica] Length = 237 Score = 57.8 bits (138), Expect = 3e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = +1 Query: 136 RVVTSMLCRTAEEHPDILFLKVNFDENKPMC 228 R + LCRTAEEHP+ILFLKVNFDENKPMC Sbjct: 132 RALFPKLCRTAEEHPEILFLKVNFDENKPMC 162 >ref|XP_011013361.1| PREDICTED: thioredoxin-like 2, chloroplastic [Populus euphratica] Length = 220 Score = 57.8 bits (138), Expect = 3e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = +1 Query: 136 RVVTSMLCRTAEEHPDILFLKVNFDENKPMC 228 R + LCRTAEEHP+ILFLKVNFDENKPMC Sbjct: 117 RALFPKLCRTAEEHPEILFLKVNFDENKPMC 147 >gb|KHN32916.1| Thioredoxin-like 2, chloroplastic [Glycine soja] Length = 212 Score = 57.8 bits (138), Expect = 3e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = +1 Query: 136 RVVTSMLCRTAEEHPDILFLKVNFDENKPMC 228 R + LCRTAEEHP+ILFLKVNFDENKPMC Sbjct: 109 RALFPKLCRTAEEHPEILFLKVNFDENKPMC 139 >ref|XP_002514101.1| Thioredoxin, putative [Ricinus communis] gi|223546557|gb|EEF48055.1| Thioredoxin, putative [Ricinus communis] Length = 227 Score = 57.8 bits (138), Expect = 3e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = +1 Query: 136 RVVTSMLCRTAEEHPDILFLKVNFDENKPMC 228 R + LCRTAEEHP+ILFLKVNFDENKPMC Sbjct: 124 RALFPKLCRTAEEHPEILFLKVNFDENKPMC 154 >ref|XP_003517423.1| PREDICTED: thioredoxin-like 2, chloroplastic-like [Glycine max] gi|947126298|gb|KRH74152.1| hypothetical protein GLYMA_01G002700 [Glycine max] Length = 212 Score = 57.8 bits (138), Expect = 3e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = +1 Query: 136 RVVTSMLCRTAEEHPDILFLKVNFDENKPMC 228 R + LCRTAEEHP+ILFLKVNFDENKPMC Sbjct: 109 RALFPKLCRTAEEHPEILFLKVNFDENKPMC 139 >gb|ACU19208.1| unknown [Glycine max] Length = 212 Score = 57.8 bits (138), Expect = 3e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = +1 Query: 136 RVVTSMLCRTAEEHPDILFLKVNFDENKPMC 228 R + LCRTAEEHP+ILFLKVNFDENKPMC Sbjct: 109 RALFPKLCRTAEEHPEILFLKVNFDENKPMC 139 >ref|XP_002282326.1| PREDICTED: thioredoxin-like 2, chloroplastic [Vitis vinifera] gi|297738677|emb|CBI27922.3| unnamed protein product [Vitis vinifera] Length = 207 Score = 57.8 bits (138), Expect = 3e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = +1 Query: 136 RVVTSMLCRTAEEHPDILFLKVNFDENKPMC 228 R + LCRTAEEHP+ILFLKVNFDENKPMC Sbjct: 115 RALFPKLCRTAEEHPEILFLKVNFDENKPMC 145 >emb|CAN62376.1| hypothetical protein VITISV_000883 [Vitis vinifera] Length = 149 Score = 57.8 bits (138), Expect = 3e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = +1 Query: 136 RVVTSMLCRTAEEHPDILFLKVNFDENKPMC 228 R + LCRTAEEHP+ILFLKVNFDENKPMC Sbjct: 57 RALFPKLCRTAEEHPEILFLKVNFDENKPMC 87 >ref|XP_004513104.1| PREDICTED: thioredoxin-like 2, chloroplastic [Cicer arietinum] Length = 216 Score = 57.0 bits (136), Expect = 5e-06 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = +1 Query: 154 LCRTAEEHPDILFLKVNFDENKPMC 228 LCRTAEEHP+ILFLKVNFDENKPMC Sbjct: 119 LCRTAEEHPEILFLKVNFDENKPMC 143 >ref|XP_003620940.1| thioredoxin [Medicago truncatula] gi|355495955|gb|AES77158.1| thioredoxin [Medicago truncatula] Length = 214 Score = 57.0 bits (136), Expect = 5e-06 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = +1 Query: 136 RVVTSMLCRTAEEHPDILFLKVNFDENKPMC 228 R + LCRTAEEHP+I+FLKVNFDENKPMC Sbjct: 111 RALFPKLCRTAEEHPEIIFLKVNFDENKPMC 141 >ref|XP_012076910.1| PREDICTED: thioredoxin-like 2, chloroplastic isoform X1 [Jatropha curcas] Length = 237 Score = 56.6 bits (135), Expect = 7e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = +1 Query: 136 RVVTSMLCRTAEEHPDILFLKVNFDENKPMC 228 R + LCRTAEE+PDILFLKVNFDENKPMC Sbjct: 128 RALFPKLCRTAEENPDILFLKVNFDENKPMC 158 >gb|KHN40327.1| Thioredoxin-like 2, chloroplastic [Glycine soja] Length = 246 Score = 56.6 bits (135), Expect = 7e-06 Identities = 23/26 (88%), Positives = 26/26 (100%) Frame = +1 Query: 151 MLCRTAEEHPDILFLKVNFDENKPMC 228 +LCRTAEEHP+I+FLKVNFDENKPMC Sbjct: 148 LLCRTAEEHPEIVFLKVNFDENKPMC 173 >ref|XP_010523570.1| PREDICTED: thioredoxin-like 2-2, chloroplastic [Tarenaya hassleriana] Length = 241 Score = 56.6 bits (135), Expect = 7e-06 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = +1 Query: 136 RVVTSMLCRTAEEHPDILFLKVNFDENKPMC 228 R + LCRTA EHPDILFLKVNFDENKPMC Sbjct: 136 RALFPKLCRTAVEHPDILFLKVNFDENKPMC 166 >ref|XP_009361589.1| PREDICTED: thioredoxin-like 2, chloroplastic [Pyrus x bretschneideri] Length = 228 Score = 56.6 bits (135), Expect = 7e-06 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = +1 Query: 136 RVVTSMLCRTAEEHPDILFLKVNFDENKPMC 228 R + LCRTAE+HP+ILFLKVNFDENKPMC Sbjct: 123 RALFPKLCRTAEDHPEILFLKVNFDENKPMC 153 >ref|XP_009352642.1| PREDICTED: thioredoxin-like 2, chloroplastic isoform X1 [Pyrus x bretschneideri] Length = 222 Score = 56.6 bits (135), Expect = 7e-06 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = +1 Query: 136 RVVTSMLCRTAEEHPDILFLKVNFDENKPMC 228 R + LCRTAE+HP+ILFLKVNFDENKPMC Sbjct: 123 RALFPKLCRTAEDHPEILFLKVNFDENKPMC 153 >ref|XP_008437900.1| PREDICTED: thioredoxin-like 2, chloroplastic [Cucumis melo] Length = 224 Score = 56.6 bits (135), Expect = 7e-06 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = +1 Query: 136 RVVTSMLCRTAEEHPDILFLKVNFDENKPMC 228 R + LCRTA+EHP+ILFLKVNFDENKPMC Sbjct: 125 RALFPRLCRTADEHPEILFLKVNFDENKPMC 155