BLASTX nr result
ID: Gardenia21_contig00032165
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00032165 (303 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP19416.1| unnamed protein product [Coffea canephora] 61 3e-09 >emb|CDP19416.1| unnamed protein product [Coffea canephora] Length = 96 Score = 61.2 bits (147), Expect(2) = 3e-09 Identities = 29/63 (46%), Positives = 40/63 (63%) Frame = -2 Query: 257 FLFDKEFGESNILLTDARAFCFDLQLYSDKNLFKLQVEVDSKVLVHFLHTSDSSTWPLLQ 78 F F KEFG+ +L +A A + LQ+ K K+ VEVDSKVLV +H+SD S WPL + Sbjct: 32 FSFSKEFGDVQVLQAEASALSYGLQICISKRFRKVLVEVDSKVLVSLIHSSDMSNWPLCK 91 Query: 77 CIV 69 ++ Sbjct: 92 VLL 94 Score = 26.6 bits (57), Expect(2) = 3e-09 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = -3 Query: 301 AAGGGLLRDH*DNLAFCSTK 242 A+GGGLLRDH L F +K Sbjct: 17 ASGGGLLRDHSGKLIFSFSK 36