BLASTX nr result
ID: Gardenia21_contig00031805
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00031805 (289 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP17986.1| unnamed protein product [Coffea canephora] 93 7e-17 >emb|CDP17986.1| unnamed protein product [Coffea canephora] Length = 216 Score = 93.2 bits (230), Expect = 7e-17 Identities = 51/84 (60%), Positives = 62/84 (73%), Gaps = 1/84 (1%) Frame = -2 Query: 288 EAVQLPLWDSKNMLKTTKRSILGQCVTSPSKRVHQ-LC*ALQDSQTAAKDYNNDEDELIY 112 EAV+ PLWD N+ K KRSIL Q + SP++ +HQ L ALQDSQ AA DY N E+ LI+ Sbjct: 125 EAVEFPLWDGNNVFKR-KRSILDQHIMSPTEMLHQQLYYALQDSQAAAGDYCNGEEVLIF 183 Query: 111 ERKYHYILENEIGIGCMLLKPLAS 40 ER HYI ENEIG+GC+LL+P AS Sbjct: 184 ERINHYIPENEIGLGCILLQPPAS 207