BLASTX nr result
ID: Gardenia21_contig00031446
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00031446 (790 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP03281.1| unnamed protein product [Coffea canephora] 84 9e-14 ref|XP_012849500.1| PREDICTED: probable glycosyltransferase At3g... 63 3e-07 ref|XP_011093625.1| PREDICTED: probable glycosyltransferase At3g... 59 5e-06 >emb|CDP03281.1| unnamed protein product [Coffea canephora] Length = 689 Score = 84.3 bits (207), Expect = 9e-14 Identities = 35/40 (87%), Positives = 40/40 (100%) Frame = -2 Query: 120 MDYTIPVRRIYQFEKWKWLLVLGLVAATHLFCQSLMLPYG 1 MDYT+P+RRIYQFEKWKWLL++GLVAATHLFCQSL+LPYG Sbjct: 1 MDYTVPIRRIYQFEKWKWLLMVGLVAATHLFCQSLILPYG 40 >ref|XP_012849500.1| PREDICTED: probable glycosyltransferase At3g07620 [Erythranthe guttatus] gi|848898749|ref|XP_012849501.1| PREDICTED: probable glycosyltransferase At3g07620 [Erythranthe guttatus] gi|604314549|gb|EYU27286.1| hypothetical protein MIMGU_mgv1a002540mg [Erythranthe guttata] Length = 661 Score = 62.8 bits (151), Expect = 3e-07 Identities = 25/40 (62%), Positives = 33/40 (82%) Frame = -2 Query: 120 MDYTIPVRRIYQFEKWKWLLVLGLVAATHLFCQSLMLPYG 1 MDY + ++++ QFEK KW+ ++GLV THLFCQSLMLPYG Sbjct: 1 MDYCVKIKKLVQFEKRKWVFLVGLVGLTHLFCQSLMLPYG 40 >ref|XP_011093625.1| PREDICTED: probable glycosyltransferase At3g07620 [Sesamum indicum] Length = 691 Score = 58.5 bits (140), Expect = 5e-06 Identities = 25/40 (62%), Positives = 33/40 (82%) Frame = -2 Query: 120 MDYTIPVRRIYQFEKWKWLLVLGLVAATHLFCQSLMLPYG 1 MDY+I ++++Q EK KWL+++GLVA THL CQSLMLP G Sbjct: 1 MDYSIKFQKLFQIEKGKWLVLVGLVALTHLVCQSLMLPNG 40