BLASTX nr result
ID: Gardenia21_contig00031228
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00031228 (421 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP17345.1| unnamed protein product [Coffea canephora] 69 1e-09 >emb|CDP17345.1| unnamed protein product [Coffea canephora] Length = 71 Score = 68.9 bits (167), Expect = 1e-09 Identities = 38/70 (54%), Positives = 41/70 (58%), Gaps = 19/70 (27%) Frame = -1 Query: 211 MGFDSTFPSYDLSA*GHSGI-------------------RLRAQRRPQWLKYFCTYQYPV 89 MGFDSTFP YDLSA GH I RL++ RR +WL YF T QYPV Sbjct: 1 MGFDSTFPGYDLSARGHRSIDKFSLPLDFKLVLAKGLCIRLKSPRRLRWLNYFNTSQYPV 60 Query: 88 IPSSTTSFSN 59 IPSSTT FSN Sbjct: 61 IPSSTTPFSN 70