BLASTX nr result
ID: Gardenia21_contig00030675
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00030675 (373 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP00357.1| unnamed protein product [Coffea canephora] 71 4e-10 ref|XP_009789554.1| PREDICTED: casparian strip membrane protein ... 64 4e-08 ref|XP_009602468.1| PREDICTED: casparian strip membrane protein ... 64 4e-08 ref|XP_010042237.1| PREDICTED: casparian strip membrane protein ... 62 2e-07 ref|XP_010066899.1| PREDICTED: casparian strip membrane protein ... 62 2e-07 ref|XP_009760874.1| PREDICTED: casparian strip membrane protein ... 61 3e-07 ref|XP_009606201.1| PREDICTED: casparian strip membrane protein ... 61 3e-07 ref|XP_006355125.1| PREDICTED: CASP-like protein SDM1_58t00016-l... 61 3e-07 ref|XP_004238811.1| PREDICTED: casparian strip membrane protein ... 61 3e-07 ref|XP_003564046.1| PREDICTED: casparian strip membrane protein ... 61 3e-07 sp|Q5NRN4.1|CASP2_SOLDE RecName: Full=Casparian strip membrane p... 61 3e-07 sp|Q60D27.1|CASP1_SOLDE RecName: Full=Casparian strip membrane p... 61 3e-07 ref|XP_011077838.1| PREDICTED: casparian strip membrane protein ... 60 5e-07 ref|XP_014511932.1| PREDICTED: CASP-like protein 2U5 [Vigna radi... 60 6e-07 ref|XP_010683143.1| PREDICTED: casparian strip membrane protein ... 60 6e-07 ref|XP_006344265.1| PREDICTED: CASP-like protein SDM1_58t00016-l... 60 6e-07 ref|XP_004237043.1| PREDICTED: casparian strip membrane protein ... 60 6e-07 ref|XP_011098775.1| PREDICTED: casparian strip membrane protein ... 60 8e-07 gb|KDO72617.1| hypothetical protein CISIN_1g045471mg [Citrus sin... 60 8e-07 ref|XP_006482625.1| PREDICTED: casparian strip membrane protein ... 60 8e-07 >emb|CDP00357.1| unnamed protein product [Coffea canephora] Length = 185 Score = 70.9 bits (172), Expect = 4e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -2 Query: 312 HNGNSSANWFAICQQFQDFCQRASGSLIGSF 220 HNGNSSANWFAICQQFQDFCQRASGSLIGSF Sbjct: 135 HNGNSSANWFAICQQFQDFCQRASGSLIGSF 165 >ref|XP_009789554.1| PREDICTED: casparian strip membrane protein 2-like [Nicotiana sylvestris] Length = 186 Score = 63.9 bits (154), Expect = 4e-08 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -2 Query: 312 HNGNSSANWFAICQQFQDFCQRASGSLIGSF 220 HNGNSSANWF+ICQQ+ DFCQR++GSLIGSF Sbjct: 136 HNGNSSANWFSICQQYTDFCQRSAGSLIGSF 166 >ref|XP_009602468.1| PREDICTED: casparian strip membrane protein 2-like [Nicotiana tomentosiformis] Length = 187 Score = 63.9 bits (154), Expect = 4e-08 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -2 Query: 312 HNGNSSANWFAICQQFQDFCQRASGSLIGSF 220 HNGNSSANWF+ICQQ+ DFCQR++GSLIGSF Sbjct: 137 HNGNSSANWFSICQQYTDFCQRSAGSLIGSF 167 >ref|XP_010042237.1| PREDICTED: casparian strip membrane protein 3-like [Eucalyptus grandis] Length = 186 Score = 61.6 bits (148), Expect = 2e-07 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -2 Query: 312 HNGNSSANWFAICQQFQDFCQRASGSLIGSF 220 HNGNSSANWFAICQQF FC+R +GSLIGSF Sbjct: 136 HNGNSSANWFAICQQFGSFCERITGSLIGSF 166 >ref|XP_010066899.1| PREDICTED: casparian strip membrane protein 3-like [Eucalyptus grandis] gi|629099177|gb|KCW64942.1| hypothetical protein EUGRSUZ_G02489 [Eucalyptus grandis] Length = 186 Score = 61.6 bits (148), Expect = 2e-07 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -2 Query: 312 HNGNSSANWFAICQQFQDFCQRASGSLIGSF 220 HNGNSSANWFAICQQF FC+R +GSLIGSF Sbjct: 136 HNGNSSANWFAICQQFGSFCERITGSLIGSF 166 >ref|XP_009760874.1| PREDICTED: casparian strip membrane protein 2 [Nicotiana sylvestris] Length = 184 Score = 61.2 bits (147), Expect = 3e-07 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = -2 Query: 312 HNGNSSANWFAICQQFQDFCQRASGSLIGSF 220 HNGN+S NWF+ICQQ+ DFCQR++GSLIGSF Sbjct: 134 HNGNTSTNWFSICQQYTDFCQRSAGSLIGSF 164 >ref|XP_009606201.1| PREDICTED: casparian strip membrane protein 2 [Nicotiana tomentosiformis] Length = 184 Score = 61.2 bits (147), Expect = 3e-07 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = -2 Query: 312 HNGNSSANWFAICQQFQDFCQRASGSLIGSF 220 HNGN+S NWF+ICQQ+ DFCQR++GSLIGSF Sbjct: 134 HNGNTSTNWFSICQQYTDFCQRSAGSLIGSF 164 >ref|XP_006355125.1| PREDICTED: CASP-like protein SDM1_58t00016-like [Solanum tuberosum] Length = 185 Score = 61.2 bits (147), Expect = 3e-07 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = -2 Query: 312 HNGNSSANWFAICQQFQDFCQRASGSLIGSF 220 HNGN+S NWF+ICQQ+ DFCQR++GSLIGSF Sbjct: 135 HNGNTSTNWFSICQQYTDFCQRSAGSLIGSF 165 >ref|XP_004238811.1| PREDICTED: casparian strip membrane protein 2 [Solanum lycopersicum] Length = 185 Score = 61.2 bits (147), Expect = 3e-07 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = -2 Query: 312 HNGNSSANWFAICQQFQDFCQRASGSLIGSF 220 HNGN+S NWF+ICQQ+ DFCQR++GSLIGSF Sbjct: 135 HNGNTSTNWFSICQQYTDFCQRSAGSLIGSF 165 >ref|XP_003564046.1| PREDICTED: casparian strip membrane protein 3 [Brachypodium distachyon] gi|391738048|sp|P0DI36.1|CASP3_BRADI RecName: Full=Casparian strip membrane protein 3; Short=BdCASP3 gi|944083494|gb|KQK18846.1| hypothetical protein BRADI_1g45110 [Brachypodium distachyon] Length = 184 Score = 61.2 bits (147), Expect = 3e-07 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 312 HNGNSSANWFAICQQFQDFCQRASGSLIGSF 220 HNGN SANWFAICQQF FC+R SGSLIGSF Sbjct: 134 HNGNVSANWFAICQQFDSFCERISGSLIGSF 164 >sp|Q5NRN4.1|CASP2_SOLDE RecName: Full=Casparian strip membrane protein 2; Short=SdCASP2 [Solanum demissum] gi|56744292|gb|AAW28571.1| plant integral membrane protein TIGR01569 containing protein [Solanum demissum] Length = 185 Score = 61.2 bits (147), Expect = 3e-07 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = -2 Query: 312 HNGNSSANWFAICQQFQDFCQRASGSLIGSF 220 HNGN+S NWF+ICQQ+ DFCQR++GSLIGSF Sbjct: 135 HNGNTSTNWFSICQQYTDFCQRSAGSLIGSF 165 >sp|Q60D27.1|CASP1_SOLDE RecName: Full=Casparian strip membrane protein 1; Short=SdCASP1 [Solanum demissum] gi|53749457|gb|AAU90311.1| plant integral membrane protein TIGR01569 containing protein [Solanum demissum] Length = 185 Score = 61.2 bits (147), Expect = 3e-07 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = -2 Query: 312 HNGNSSANWFAICQQFQDFCQRASGSLIGSF 220 HNGN+S NWF+ICQQ+ DFCQR++GSLIGSF Sbjct: 135 HNGNTSTNWFSICQQYTDFCQRSAGSLIGSF 165 >ref|XP_011077838.1| PREDICTED: casparian strip membrane protein 1 [Sesamum indicum] Length = 205 Score = 60.5 bits (145), Expect = 5e-07 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = -2 Query: 312 HNGNSSANWFAICQQFQDFCQRASGSLIGSF 220 HNGNS ANW AICQQF DFCQR SG+++GSF Sbjct: 155 HNGNSDANWLAICQQFTDFCQRVSGAVVGSF 185 >ref|XP_014511932.1| PREDICTED: CASP-like protein 2U5 [Vigna radiata var. radiata] Length = 214 Score = 60.1 bits (144), Expect = 6e-07 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = -2 Query: 312 HNGNSSANWFAICQQFQDFCQRASGSLIGSF 220 HNGN+ ANWFAICQQF +FC+R SGSLIGS+ Sbjct: 164 HNGNTGANWFAICQQFNNFCERISGSLIGSY 194 >ref|XP_010683143.1| PREDICTED: casparian strip membrane protein 3 [Beta vulgaris subsp. vulgaris] gi|870855293|gb|KMT07026.1| hypothetical protein BVRB_6g153570 [Beta vulgaris subsp. vulgaris] Length = 184 Score = 60.1 bits (144), Expect = 6e-07 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = -2 Query: 312 HNGNSSANWFAICQQFQDFCQRASGSLIGSF 220 H GN+SANWFAICQQF FC+R SGSLIGSF Sbjct: 133 HKGNTSANWFAICQQFDSFCERISGSLIGSF 163 >ref|XP_006344265.1| PREDICTED: CASP-like protein SDM1_58t00016-like [Solanum tuberosum] Length = 185 Score = 60.1 bits (144), Expect = 6e-07 Identities = 23/31 (74%), Positives = 29/31 (93%) Frame = -2 Query: 312 HNGNSSANWFAICQQFQDFCQRASGSLIGSF 220 H GN+SANWF++CQQ+ DFCQR++GSLIGSF Sbjct: 135 HTGNTSANWFSVCQQYTDFCQRSAGSLIGSF 165 >ref|XP_004237043.1| PREDICTED: casparian strip membrane protein 2-like [Solanum lycopersicum] Length = 185 Score = 60.1 bits (144), Expect = 6e-07 Identities = 23/31 (74%), Positives = 29/31 (93%) Frame = -2 Query: 312 HNGNSSANWFAICQQFQDFCQRASGSLIGSF 220 H GN+SANWF++CQQ+ DFCQR++GSLIGSF Sbjct: 135 HTGNTSANWFSVCQQYTDFCQRSAGSLIGSF 165 >ref|XP_011098775.1| PREDICTED: casparian strip membrane protein 1-like [Sesamum indicum] Length = 189 Score = 59.7 bits (143), Expect = 8e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 312 HNGNSSANWFAICQQFQDFCQRASGSLIGSF 220 H GN+ ANWFAICQQF FCQR SGSLIGSF Sbjct: 138 HKGNTRANWFAICQQFNSFCQRTSGSLIGSF 168 >gb|KDO72617.1| hypothetical protein CISIN_1g045471mg [Citrus sinensis] Length = 185 Score = 59.7 bits (143), Expect = 8e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 312 HNGNSSANWFAICQQFQDFCQRASGSLIGSF 220 H GN+ ANWFAICQQF FCQR SGSLIGSF Sbjct: 135 HKGNAKANWFAICQQFNSFCQRISGSLIGSF 165 >ref|XP_006482625.1| PREDICTED: casparian strip membrane protein VIT_14s0108g01050-like [Citrus sinensis] Length = 185 Score = 59.7 bits (143), Expect = 8e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 312 HNGNSSANWFAICQQFQDFCQRASGSLIGSF 220 H GN+ ANWFAICQQF FCQR SGSLIGSF Sbjct: 135 HKGNAKANWFAICQQFNSFCQRISGSLIGSF 165