BLASTX nr result
ID: Gardenia21_contig00028634
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00028634 (393 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP20012.1| unnamed protein product [Coffea canephora] 62 2e-07 emb|CDP10786.1| unnamed protein product [Coffea canephora] 57 7e-06 >emb|CDP20012.1| unnamed protein product [Coffea canephora] Length = 144 Score = 62.0 bits (149), Expect = 2e-07 Identities = 31/39 (79%), Positives = 32/39 (82%) Frame = -3 Query: 391 AVDLSAFGINTRSIREIHTFEDYAELLMELMVAIPVDEK 275 AVDLSA INT+SI EIHT EDYAE LMELM AIP DEK Sbjct: 42 AVDLSASSINTKSIHEIHTLEDYAEPLMELMAAIPADEK 80 >emb|CDP10786.1| unnamed protein product [Coffea canephora] Length = 268 Score = 56.6 bits (135), Expect = 7e-06 Identities = 26/39 (66%), Positives = 31/39 (79%) Frame = -3 Query: 391 AVDLSAFGINTRSIREIHTFEDYAELLMELMVAIPVDEK 275 A+DLSA GINT+S+ EIHT DYAE LME M A+P D+K Sbjct: 42 AIDLSASGINTKSLDEIHTLHDYAEPLMEFMAAVPPDQK 80