BLASTX nr result
ID: Gardenia21_contig00028372
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00028372 (303 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP08059.1| unnamed protein product [Coffea canephora] 66 1e-08 >emb|CDP08059.1| unnamed protein product [Coffea canephora] Length = 314 Score = 65.9 bits (159), Expect = 1e-08 Identities = 38/82 (46%), Positives = 48/82 (58%) Frame = -1 Query: 252 QVFADGEDYSYKHDEETSRDYHLERSPSLEQXXXXXXXXXXXXXXSTQNHKRSIQVSADG 73 +V AD EDYSYKHDEETSRDYHLERSPSL+Q S+++HKRS D Sbjct: 212 RVSADREDYSYKHDEETSRDYHLERSPSLDQSSDRWRRSRDRHDRSSKHHKRSRHSHRDE 271 Query: 72 EDYSYKHDEGTSRDYHLERSPS 7 + + + G S ++RS S Sbjct: 272 KKSNSRDHSGVSGS--MDRSSS 291 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -1 Query: 99 RSIQVSADGEDYSYKHDEGTSRDYHLERSPSLE 1 R +VSAD EDYSYKHDE TSRDYHLERSPSL+ Sbjct: 209 RRKRVSADREDYSYKHDEETSRDYHLERSPSLD 241