BLASTX nr result
ID: Gardenia21_contig00028123
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00028123 (325 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP16446.1| unnamed protein product [Coffea canephora] 52 9e-07 >emb|CDP16446.1| unnamed protein product [Coffea canephora] Length = 846 Score = 52.0 bits (123), Expect(2) = 9e-07 Identities = 37/90 (41%), Positives = 42/90 (46%) Frame = -2 Query: 312 LKIMTRAPLQSLPEGGLPPFLTTLEIFDHPXXXXXXXXXXXEDWSKIADIPT**LIKN*S 133 L IMT PLQSL E GLP T+LEIFD P +DW +I DIP Sbjct: 751 LTIMTCTPLQSLLEKGLP---TSLEIFDCPLLKPKLEWEKRQDWPEITDIP--------- 798 Query: 132 LQRNS*SVRDPAVTRPPSSLWIKV*NCILP 43 +PPSSLWIK +C LP Sbjct: 799 -------------AQPPSSLWIK--DCTLP 813 Score = 27.3 bits (59), Expect(2) = 9e-07 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -3 Query: 44 PSREHSSLLLSASA 3 PSRE+SSLLLSASA Sbjct: 813 PSREYSSLLLSASA 826