BLASTX nr result
ID: Gardenia21_contig00028110
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00028110 (204 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP16808.1| unnamed protein product [Coffea canephora] 61 4e-07 emb|CDP20262.1| unnamed protein product, partial [Coffea canephora] 60 8e-07 emb|CDP17559.1| unnamed protein product [Coffea canephora] 59 1e-06 emb|CDP20542.1| unnamed protein product [Coffea canephora] 59 1e-06 emb|CDP21293.1| unnamed protein product [Coffea canephora] 59 1e-06 emb|CDP21312.1| unnamed protein product [Coffea canephora] 59 1e-06 emb|CDP21584.1| unnamed protein product [Coffea canephora] 59 1e-06 emb|CDP21725.1| unnamed protein product [Coffea canephora] 59 1e-06 emb|CDP17557.1| unnamed protein product [Coffea canephora] 59 1e-06 emb|CDP20772.1| unnamed protein product [Coffea canephora] 59 1e-06 emb|CDP19798.1| unnamed protein product [Coffea canephora] 58 2e-06 emb|CDP21009.1| unnamed protein product [Coffea canephora] 58 2e-06 emb|CDP21044.1| unnamed protein product [Coffea canephora] 58 2e-06 emb|CDP17544.1| unnamed protein product [Coffea canephora] 58 3e-06 emb|CDP19195.1| unnamed protein product [Coffea canephora] 58 3e-06 emb|CDP18602.1| unnamed protein product, partial [Coffea canephora] 57 4e-06 emb|CDP13082.1| unnamed protein product [Coffea canephora] 57 5e-06 emb|CDP20339.1| unnamed protein product [Coffea canephora] 57 5e-06 emb|CDP19354.1| unnamed protein product [Coffea canephora] 57 7e-06 emb|CDP17680.1| unnamed protein product [Coffea canephora] 56 9e-06 >emb|CDP16808.1| unnamed protein product [Coffea canephora] Length = 1157 Score = 60.8 bits (146), Expect = 4e-07 Identities = 34/70 (48%), Positives = 44/70 (62%), Gaps = 8/70 (11%) Frame = -2 Query: 188 QSFELDKIIFLSHLVRFF--------SPQTVQAWLQQLEEEVSNPDNVLDELNYENLHWE 33 + FEL+++ + ++R F Q VQ WL+QLEEEV DNVLDELNYE L + Sbjct: 217 REFELERLNKTAEMIRGFLAGADEQMHSQGVQYWLKQLEEEVFKADNVLDELNYEKLRRK 276 Query: 32 VKNRNQLKKK 3 VK +NQL KK Sbjct: 277 VKYQNQLMKK 286 >emb|CDP20262.1| unnamed protein product, partial [Coffea canephora] Length = 1033 Score = 59.7 bits (143), Expect = 8e-07 Identities = 29/40 (72%), Positives = 32/40 (80%) Frame = -2 Query: 122 VQAWLQQLEEEVSNPDNVLDELNYENLHWEVKNRNQLKKK 3 VQ WL+QLEEEV DNVLDELNYENL +VK +NQL KK Sbjct: 66 VQKWLKQLEEEVFKADNVLDELNYENLRQKVKYQNQLTKK 105 >emb|CDP17559.1| unnamed protein product [Coffea canephora] Length = 641 Score = 59.3 bits (142), Expect = 1e-06 Identities = 29/40 (72%), Positives = 32/40 (80%) Frame = -2 Query: 122 VQAWLQQLEEEVSNPDNVLDELNYENLHWEVKNRNQLKKK 3 VQ WL+QLEEEV DNVLDELNYENL +VK +NQL KK Sbjct: 66 VQKWLKQLEEEVFKADNVLDELNYENLRRKVKYQNQLTKK 105 >emb|CDP20542.1| unnamed protein product [Coffea canephora] Length = 1094 Score = 59.3 bits (142), Expect = 1e-06 Identities = 29/40 (72%), Positives = 32/40 (80%) Frame = -2 Query: 122 VQAWLQQLEEEVSNPDNVLDELNYENLHWEVKNRNQLKKK 3 VQ WL+QLEEEV DNVLDELNYENL +VK +NQL KK Sbjct: 66 VQNWLKQLEEEVFKADNVLDELNYENLRQKVKYQNQLMKK 105 >emb|CDP21293.1| unnamed protein product [Coffea canephora] Length = 1149 Score = 59.3 bits (142), Expect = 1e-06 Identities = 29/40 (72%), Positives = 32/40 (80%) Frame = -2 Query: 122 VQAWLQQLEEEVSNPDNVLDELNYENLHWEVKNRNQLKKK 3 VQ WL+QLEEEV DNVLDELNYENL +VK +NQL KK Sbjct: 66 VQKWLKQLEEEVFKADNVLDELNYENLRRKVKYQNQLTKK 105 >emb|CDP21312.1| unnamed protein product [Coffea canephora] Length = 1172 Score = 59.3 bits (142), Expect = 1e-06 Identities = 29/40 (72%), Positives = 32/40 (80%) Frame = -2 Query: 122 VQAWLQQLEEEVSNPDNVLDELNYENLHWEVKNRNQLKKK 3 VQ WL+QLEEEV DNVLDELNYENL +VK +NQL KK Sbjct: 61 VQKWLKQLEEEVFKADNVLDELNYENLRRKVKYQNQLTKK 100 >emb|CDP21584.1| unnamed protein product [Coffea canephora] Length = 438 Score = 59.3 bits (142), Expect = 1e-06 Identities = 29/40 (72%), Positives = 32/40 (80%) Frame = -2 Query: 122 VQAWLQQLEEEVSNPDNVLDELNYENLHWEVKNRNQLKKK 3 VQ WL+QLEEEV DNVLDELNYENL +VK +NQL KK Sbjct: 61 VQIWLKQLEEEVFKADNVLDELNYENLRRKVKYQNQLTKK 100 >emb|CDP21725.1| unnamed protein product [Coffea canephora] Length = 1230 Score = 59.3 bits (142), Expect = 1e-06 Identities = 29/40 (72%), Positives = 32/40 (80%) Frame = -2 Query: 122 VQAWLQQLEEEVSNPDNVLDELNYENLHWEVKNRNQLKKK 3 VQ WL+QLEEEV DNVLDELNYENL +VK +NQL KK Sbjct: 18 VQNWLKQLEEEVFKADNVLDELNYENLRGKVKYQNQLTKK 57 >emb|CDP17557.1| unnamed protein product [Coffea canephora] Length = 1174 Score = 58.9 bits (141), Expect = 1e-06 Identities = 29/40 (72%), Positives = 32/40 (80%) Frame = -2 Query: 122 VQAWLQQLEEEVSNPDNVLDELNYENLHWEVKNRNQLKKK 3 VQ WL+QLEEEV DNVLDELNYENL +VK +NQL KK Sbjct: 61 VQNWLKQLEEEVFKADNVLDELNYENLRRKVKYQNQLTKK 100 >emb|CDP20772.1| unnamed protein product [Coffea canephora] Length = 1202 Score = 58.9 bits (141), Expect = 1e-06 Identities = 29/40 (72%), Positives = 32/40 (80%) Frame = -2 Query: 122 VQAWLQQLEEEVSNPDNVLDELNYENLHWEVKNRNQLKKK 3 VQ WL+QLEEEV DNVLDELNYENL +VK +NQL KK Sbjct: 61 VQNWLKQLEEEVFKADNVLDELNYENLRRKVKYQNQLTKK 100 >emb|CDP19798.1| unnamed protein product [Coffea canephora] Length = 913 Score = 58.2 bits (139), Expect = 2e-06 Identities = 28/40 (70%), Positives = 32/40 (80%) Frame = -2 Query: 122 VQAWLQQLEEEVSNPDNVLDELNYENLHWEVKNRNQLKKK 3 VQ WL+QLEEEV DNVLDELNYENL +VK ++QL KK Sbjct: 66 VQKWLEQLEEEVFKADNVLDELNYENLRRQVKYQHQLMKK 105 >emb|CDP21009.1| unnamed protein product [Coffea canephora] Length = 1184 Score = 58.2 bits (139), Expect = 2e-06 Identities = 28/40 (70%), Positives = 32/40 (80%) Frame = -2 Query: 122 VQAWLQQLEEEVSNPDNVLDELNYENLHWEVKNRNQLKKK 3 VQ WL+QLEEEV DNVLDELNY+NL +VK +NQL KK Sbjct: 66 VQKWLKQLEEEVFKADNVLDELNYDNLRRKVKYQNQLTKK 105 >emb|CDP21044.1| unnamed protein product [Coffea canephora] Length = 1050 Score = 58.2 bits (139), Expect = 2e-06 Identities = 28/40 (70%), Positives = 32/40 (80%) Frame = -2 Query: 122 VQAWLQQLEEEVSNPDNVLDELNYENLHWEVKNRNQLKKK 3 +Q WL+QLEEEV DNVLDELNYENL +VK +NQL KK Sbjct: 66 LQKWLKQLEEEVFKADNVLDELNYENLRRKVKYQNQLTKK 105 >emb|CDP17544.1| unnamed protein product [Coffea canephora] Length = 1155 Score = 57.8 bits (138), Expect = 3e-06 Identities = 28/40 (70%), Positives = 32/40 (80%) Frame = -2 Query: 122 VQAWLQQLEEEVSNPDNVLDELNYENLHWEVKNRNQLKKK 3 VQ WL++LEEEV DNVLDELNYENL +VK +NQL KK Sbjct: 61 VQIWLKRLEEEVFKADNVLDELNYENLRRKVKYQNQLTKK 100 >emb|CDP19195.1| unnamed protein product [Coffea canephora] Length = 1549 Score = 57.8 bits (138), Expect = 3e-06 Identities = 28/40 (70%), Positives = 32/40 (80%) Frame = -2 Query: 122 VQAWLQQLEEEVSNPDNVLDELNYENLHWEVKNRNQLKKK 3 VQ WL++LEEEV DNVLDELNYENL +VK +NQL KK Sbjct: 418 VQIWLKRLEEEVFKADNVLDELNYENLRRKVKYQNQLTKK 457 >emb|CDP18602.1| unnamed protein product, partial [Coffea canephora] Length = 459 Score = 57.4 bits (137), Expect = 4e-06 Identities = 28/40 (70%), Positives = 31/40 (77%) Frame = -2 Query: 122 VQAWLQQLEEEVSNPDNVLDELNYENLHWEVKNRNQLKKK 3 VQ WL+ LEEEV DNVLDELNYENL +VK +NQL KK Sbjct: 48 VQKWLKDLEEEVFKADNVLDELNYENLRRKVKYQNQLTKK 87 >emb|CDP13082.1| unnamed protein product [Coffea canephora] Length = 772 Score = 57.0 bits (136), Expect = 5e-06 Identities = 27/40 (67%), Positives = 33/40 (82%) Frame = -2 Query: 122 VQAWLQQLEEEVSNPDNVLDELNYENLHWEVKNRNQLKKK 3 V+ WL+QLE E+ ++VLDELNYENL EVK+RNQLKKK Sbjct: 61 VKNWLEQLEGELFKAEDVLDELNYENLRREVKDRNQLKKK 100 >emb|CDP20339.1| unnamed protein product [Coffea canephora] Length = 1222 Score = 57.0 bits (136), Expect = 5e-06 Identities = 28/42 (66%), Positives = 32/42 (76%) Frame = -2 Query: 128 QTVQAWLQQLEEEVSNPDNVLDELNYENLHWEVKNRNQLKKK 3 Q V+ WL+QLE+EV DNVLDELNY+NL EVK RNQ KK Sbjct: 59 QGVREWLKQLEDEVFKADNVLDELNYDNLRREVKYRNQPMKK 100 >emb|CDP19354.1| unnamed protein product [Coffea canephora] Length = 1044 Score = 56.6 bits (135), Expect = 7e-06 Identities = 28/40 (70%), Positives = 31/40 (77%) Frame = -2 Query: 122 VQAWLQQLEEEVSNPDNVLDELNYENLHWEVKNRNQLKKK 3 VQ WL+QLEEEV DNVLDEL YENL +VK +NQL KK Sbjct: 61 VQNWLKQLEEEVFKADNVLDELTYENLRRKVKYQNQLTKK 100 >emb|CDP17680.1| unnamed protein product [Coffea canephora] Length = 1105 Score = 56.2 bits (134), Expect = 9e-06 Identities = 27/40 (67%), Positives = 32/40 (80%) Frame = -2 Query: 122 VQAWLQQLEEEVSNPDNVLDELNYENLHWEVKNRNQLKKK 3 V+ WL+QLEEEV DNVLDELNY+NL +VK +NQL KK Sbjct: 57 VKNWLKQLEEEVFKADNVLDELNYDNLRRKVKYQNQLTKK 96