BLASTX nr result
ID: Gardenia21_contig00027080
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00027080 (209 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP20813.1| unnamed protein product [Coffea canephora] 125 9e-27 >emb|CDP20813.1| unnamed protein product [Coffea canephora] Length = 233 Score = 125 bits (315), Expect = 9e-27 Identities = 58/69 (84%), Positives = 61/69 (88%) Frame = -2 Query: 208 LHPPILRNQAAIPIAFSPQVFYLLRRNGKKMLKLPHYRNHHQPLRPCCVNDKQDSHTKES 29 LHPPIL NQAAIP+AFSPQV YL R+NGKKML LP+YRNHH PLRPCCVND QDS TKES Sbjct: 25 LHPPILHNQAAIPVAFSPQVLYLRRQNGKKMLILPNYRNHHHPLRPCCVNDNQDSQTKES 84 Query: 28 SDISSPEQT 2 SDIS PEQT Sbjct: 85 SDISLPEQT 93