BLASTX nr result
ID: Gardenia21_contig00026495
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00026495 (219 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP00468.1| unnamed protein product [Coffea canephora] 62 2e-07 >emb|CDP00468.1| unnamed protein product [Coffea canephora] Length = 153 Score = 62.0 bits (149), Expect = 2e-07 Identities = 35/66 (53%), Positives = 41/66 (62%) Frame = -3 Query: 199 LRNGRMIGNLQQQLKWTGEESMIMMNSTLAKLKAMGADEMMNNXXXXXXXXXXXXENMAS 20 LR MIGNLQ++++ GE S IMMNST AKLKA+GADEMMNN EN Sbjct: 3 LRTDIMIGNLQEKMRGIGEGSTIMMNSTQAKLKAVGADEMMNNLVEKLKQLFMMLENFGL 62 Query: 19 FSVGWL 2 F +G L Sbjct: 63 FLIGRL 68