BLASTX nr result
ID: Gardenia21_contig00026487
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00026487 (307 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP09372.1| unnamed protein product [Coffea canephora] 200 4e-49 ref|XP_011627016.1| PREDICTED: pentatricopeptide repeat-containi... 145 2e-32 ref|XP_009606212.1| PREDICTED: pentatricopeptide repeat-containi... 145 2e-32 ref|XP_011093422.1| PREDICTED: pentatricopeptide repeat-containi... 144 2e-32 ref|XP_009790679.1| PREDICTED: pentatricopeptide repeat-containi... 144 3e-32 ref|XP_006354576.1| PREDICTED: pentatricopeptide repeat-containi... 141 2e-31 ref|XP_010323290.1| PREDICTED: pentatricopeptide repeat-containi... 137 4e-30 ref|XP_010276956.1| PREDICTED: pentatricopeptide repeat-containi... 131 2e-28 ref|XP_012844725.1| PREDICTED: pentatricopeptide repeat-containi... 130 4e-28 gb|EYU31326.1| hypothetical protein MIMGU_mgv1a018486mg [Erythra... 130 4e-28 ref|XP_010678452.1| PREDICTED: pentatricopeptide repeat-containi... 125 2e-26 ref|XP_012831343.1| PREDICTED: pentatricopeptide repeat-containi... 123 5e-26 gb|EYU42273.1| hypothetical protein MIMGU_mgv1a025872mg, partial... 123 5e-26 ref|XP_008810790.1| PREDICTED: pentatricopeptide repeat-containi... 122 1e-25 ref|XP_009384595.1| PREDICTED: pentatricopeptide repeat-containi... 120 3e-25 gb|KNA15388.1| hypothetical protein SOVF_098680 [Spinacia oleracea] 119 9e-25 ref|XP_010921784.1| PREDICTED: pentatricopeptide repeat-containi... 117 4e-24 ref|XP_009597485.1| PREDICTED: pentatricopeptide repeat-containi... 117 4e-24 ref|XP_009597484.1| PREDICTED: pentatricopeptide repeat-containi... 117 4e-24 ref|XP_009793646.1| PREDICTED: pentatricopeptide repeat-containi... 116 8e-24 >emb|CDP09372.1| unnamed protein product [Coffea canephora] Length = 559 Score = 200 bits (508), Expect = 4e-49 Identities = 97/102 (95%), Positives = 99/102 (97%) Frame = +2 Query: 2 EPDSVTFLGLLIACAHCGLVGQGWKYFNLMEMWKLIPKPEHYAVMVDLLSRSGLVVEAYE 181 EPDSVTF+GLLIACAH GLVGQGWKYFN M+ WKLIPKPEHYAVMVDLLSRSGLVVEAYE Sbjct: 414 EPDSVTFVGLLIACAHSGLVGQGWKYFNSMQKWKLIPKPEHYAVMVDLLSRSGLVVEAYE 473 Query: 182 LVKQLPLNLPVYAWETLLSSCRVHENFELADIVAKKLSSLER 307 LVKQLPLNLPVYAWETLLSSCRVHENFELADIVAKKLSSLER Sbjct: 474 LVKQLPLNLPVYAWETLLSSCRVHENFELADIVAKKLSSLER 515 >ref|XP_011627016.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like [Amborella trichopoda] Length = 669 Score = 145 bits (365), Expect = 2e-32 Identities = 67/102 (65%), Positives = 83/102 (81%), Gaps = 1/102 (0%) Frame = +2 Query: 2 EPDSVTFLGLLIACAHCGLVGQGWKYFNLMEM-WKLIPKPEHYAVMVDLLSRSGLVVEAY 178 EPD VTFLGLL AC H GLV QGW+YFN+M+ W LIPKPEHYA MVDLL R+GL+ +AY Sbjct: 482 EPDHVTFLGLLSACVHGGLVDQGWQYFNMMQTEWNLIPKPEHYACMVDLLGRNGLLSQAY 541 Query: 179 ELVKQLPLNLPVYAWETLLSSCRVHENFELADIVAKKLSSLE 304 E +KQ+PL++ +AWETLLS+CRVH N EL ++VA K+ SL+ Sbjct: 542 EFIKQIPLDVSSHAWETLLSACRVHGNVELGEVVANKILSLQ 583 >ref|XP_009606212.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like [Nicotiana tomentosiformis] Length = 670 Score = 145 bits (365), Expect = 2e-32 Identities = 68/102 (66%), Positives = 82/102 (80%), Gaps = 1/102 (0%) Frame = +2 Query: 2 EPDSVTFLGLLIACAHCGLVGQGWKYFNLMEM-WKLIPKPEHYAVMVDLLSRSGLVVEAY 178 EPD VTFLG+L ACAH GLV GW YF ME W +IPK EHY MVDLL RSG++ EA+ Sbjct: 485 EPDHVTFLGVLTACAHSGLVDVGWSYFISMEKRWSIIPKAEHYNCMVDLLGRSGMLAEAF 544 Query: 179 ELVKQLPLNLPVYAWETLLSSCRVHENFELADIVAKKLSSLE 304 ELV+Q+P+NLP +AWETLLS CRVHENF+L D+VA+KL S++ Sbjct: 545 ELVEQIPVNLPAHAWETLLSCCRVHENFDLGDLVAQKLLSVQ 586 >ref|XP_011093422.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like [Sesamum indicum] Length = 652 Score = 144 bits (364), Expect = 2e-32 Identities = 63/97 (64%), Positives = 78/97 (80%) Frame = +2 Query: 2 EPDSVTFLGLLIACAHCGLVGQGWKYFNLMEMWKLIPKPEHYAVMVDLLSRSGLVVEAYE 181 +PD VTFL LL ACAH GL+ WKYF LME WKL PKP+HYA MVDLL RSGLV EA+E Sbjct: 471 QPDHVTFLVLLTACAHSGLITDAWKYFKLMERWKLTPKPQHYACMVDLLGRSGLVAEAFE 530 Query: 182 LVKQLPLNLPVYAWETLLSSCRVHENFELADIVAKKL 292 LV QLP++ PVY W+TLLS+C +H N++L D++A+K+ Sbjct: 531 LVNQLPVDHPVYTWQTLLSACSIHANYDLGDVIAEKI 567 >ref|XP_009790679.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like [Nicotiana sylvestris] Length = 673 Score = 144 bits (362), Expect = 3e-32 Identities = 68/102 (66%), Positives = 80/102 (78%), Gaps = 1/102 (0%) Frame = +2 Query: 2 EPDSVTFLGLLIACAHCGLVGQGWKYFNLMEM-WKLIPKPEHYAVMVDLLSRSGLVVEAY 178 EPD VTFLG+L ACAH GLV GW YF ME W +IPK EHY MVDLL RSG++ EA+ Sbjct: 471 EPDHVTFLGVLTACAHSGLVDMGWSYFISMEKRWSIIPKAEHYNCMVDLLGRSGMLAEAF 530 Query: 179 ELVKQLPLNLPVYAWETLLSSCRVHENFELADIVAKKLSSLE 304 +LVKQ+P++LP AWETL S CRVHENF+L D+VAKKL SL+ Sbjct: 531 DLVKQIPVDLPARAWETLFSCCRVHENFDLGDLVAKKLLSLQ 572 >ref|XP_006354576.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like [Solanum tuberosum] Length = 616 Score = 141 bits (356), Expect = 2e-31 Identities = 68/102 (66%), Positives = 82/102 (80%), Gaps = 1/102 (0%) Frame = +2 Query: 2 EPDSVTFLGLLIACAHCGLVGQGWKYFNLMEM-WKLIPKPEHYAVMVDLLSRSGLVVEAY 178 EPD VTFLG+L ACAH GLV +GW YF ME W +IPK EHY MVDLL RSG++ EA+ Sbjct: 414 EPDHVTFLGVLTACAHSGLVDEGWSYFVSMEKRWSIIPKSEHYNCMVDLLGRSGMLTEAF 473 Query: 179 ELVKQLPLNLPVYAWETLLSSCRVHENFELADIVAKKLSSLE 304 ELVKQ+PL+LP +A ETLLS CRVHENF+L+D+V +KL SL+ Sbjct: 474 ELVKQIPLDLPAHARETLLSCCRVHENFDLSDLVEQKLLSLQ 515 >ref|XP_010323290.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like [Solanum lycopersicum] gi|723659243|ref|XP_010323293.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like [Solanum lycopersicum] gi|723659246|ref|XP_010323298.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like [Solanum lycopersicum] gi|723659249|ref|XP_010323302.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like [Solanum lycopersicum] gi|723659252|ref|XP_010323309.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like [Solanum lycopersicum] gi|723659255|ref|XP_010323311.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like [Solanum lycopersicum] Length = 673 Score = 137 bits (344), Expect = 4e-30 Identities = 65/102 (63%), Positives = 80/102 (78%), Gaps = 1/102 (0%) Frame = +2 Query: 2 EPDSVTFLGLLIACAHCGLVGQGWKYFNLMEM-WKLIPKPEHYAVMVDLLSRSGLVVEAY 178 EPD VTFLG+L ACAH GLV +GW YF ME W + PK EHY MVDLL RSG++ EA+ Sbjct: 471 EPDHVTFLGVLTACAHSGLVDEGWSYFVSMERRWSITPKAEHYNCMVDLLGRSGMLAEAF 530 Query: 179 ELVKQLPLNLPVYAWETLLSSCRVHENFELADIVAKKLSSLE 304 EL+KQ+PL+ P +A ETLLS CRVHENF+L+D+V +KL SL+ Sbjct: 531 ELIKQIPLDPPAHAQETLLSCCRVHENFDLSDLVEQKLLSLQ 572 >ref|XP_010276956.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like [Nelumbo nucifera] Length = 613 Score = 131 bits (329), Expect = 2e-28 Identities = 58/98 (59%), Positives = 75/98 (76%) Frame = +2 Query: 5 PDSVTFLGLLIACAHCGLVGQGWKYFNLMEMWKLIPKPEHYAVMVDLLSRSGLVVEAYEL 184 PD+VTFLG+L ACAH GLV +GWKYF ME W LIP+P HYA MV+L RSGL+ EAY Sbjct: 433 PDNVTFLGILTACAHRGLVDEGWKYFRSMEDWNLIPEPAHYACMVNLFGRSGLLNEAYNF 492 Query: 185 VKQLPLNLPVYAWETLLSSCRVHENFELADIVAKKLSS 298 +KQ+ + LP +AWETLL +CR+ N EL ++V+K++ S Sbjct: 493 IKQIHVGLPTHAWETLLGACRIQGNLELGELVSKEIFS 530 >ref|XP_012844725.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like [Erythranthe guttatus] Length = 599 Score = 130 bits (327), Expect = 4e-28 Identities = 59/97 (60%), Positives = 73/97 (75%) Frame = +2 Query: 2 EPDSVTFLGLLIACAHCGLVGQGWKYFNLMEMWKLIPKPEHYAVMVDLLSRSGLVVEAYE 181 +PD VTFL LL ACAH GLV +GWKY LM W L PKPEH A MVDLL RSGL+VEA++ Sbjct: 414 QPDHVTFLVLLTACAHSGLVSEGWKYLKLMGKWNLTPKPEHLASMVDLLGRSGLLVEAFK 473 Query: 182 LVKQLPLNLPVYAWETLLSSCRVHENFELADIVAKKL 292 LV Q ++P YAW LLS+C +H N+EL+D++A K+ Sbjct: 474 LVNQFHSDIPTYAWGALLSACNMHGNYELSDLIADKI 510 >gb|EYU31326.1| hypothetical protein MIMGU_mgv1a018486mg [Erythranthe guttata] Length = 658 Score = 130 bits (327), Expect = 4e-28 Identities = 59/97 (60%), Positives = 73/97 (75%) Frame = +2 Query: 2 EPDSVTFLGLLIACAHCGLVGQGWKYFNLMEMWKLIPKPEHYAVMVDLLSRSGLVVEAYE 181 +PD VTFL LL ACAH GLV +GWKY LM W L PKPEH A MVDLL RSGL+VEA++ Sbjct: 473 QPDHVTFLVLLTACAHSGLVSEGWKYLKLMGKWNLTPKPEHLASMVDLLGRSGLLVEAFK 532 Query: 182 LVKQLPLNLPVYAWETLLSSCRVHENFELADIVAKKL 292 LV Q ++P YAW LLS+C +H N+EL+D++A K+ Sbjct: 533 LVNQFHSDIPTYAWGALLSACNMHGNYELSDLIADKI 569 >ref|XP_010678452.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like [Beta vulgaris subsp. vulgaris] gi|870859301|gb|KMT10757.1| hypothetical protein BVRB_5g114150 [Beta vulgaris subsp. vulgaris] Length = 644 Score = 125 bits (313), Expect = 2e-26 Identities = 58/100 (58%), Positives = 77/100 (77%), Gaps = 1/100 (1%) Frame = +2 Query: 2 EPDSVTFLGLLIACAHCGLVGQGWKYFNLMEM-WKLIPKPEHYAVMVDLLSRSGLVVEAY 178 +P+ +TFL LL ACAH GLV +G KYF ME W + P+PEHYA M+DL RSG++ EA+ Sbjct: 459 KPNRITFLALLTACAHSGLVKEGRKYFKSMENEWHITPQPEHYACMIDLFGRSGMLYEAF 518 Query: 179 ELVKQLPLNLPVYAWETLLSSCRVHENFELADIVAKKLSS 298 ELVK L L++P YAWETLL+ C++H NFEL +IV++K+ S Sbjct: 519 ELVKHLTLDVPSYAWETLLNYCKLHGNFELGEIVSQKILS 558 >ref|XP_012831343.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like [Erythranthe guttatus] Length = 599 Score = 123 bits (309), Expect = 5e-26 Identities = 57/97 (58%), Positives = 71/97 (73%) Frame = +2 Query: 2 EPDSVTFLGLLIACAHCGLVGQGWKYFNLMEMWKLIPKPEHYAVMVDLLSRSGLVVEAYE 181 +PD VTFL LL ACAH GLV +GWKY LM L PKPEH A MVDLL RSGL+ EA++ Sbjct: 414 QPDHVTFLVLLTACAHSGLVSEGWKYLKLMGKCDLTPKPEHLASMVDLLGRSGLLAEAFK 473 Query: 182 LVKQLPLNLPVYAWETLLSSCRVHENFELADIVAKKL 292 LV Q ++P YAW LLS+C +H N+EL+D++A K+ Sbjct: 474 LVNQFHSDIPTYAWGALLSACNMHGNYELSDLIADKI 510 >gb|EYU42273.1| hypothetical protein MIMGU_mgv1a025872mg, partial [Erythranthe guttata] Length = 691 Score = 123 bits (309), Expect = 5e-26 Identities = 57/97 (58%), Positives = 71/97 (73%) Frame = +2 Query: 2 EPDSVTFLGLLIACAHCGLVGQGWKYFNLMEMWKLIPKPEHYAVMVDLLSRSGLVVEAYE 181 +PD VTFL LL ACAH GLV +GWKY LM L PKPEH A MVDLL RSGL+ EA++ Sbjct: 512 QPDHVTFLVLLTACAHSGLVSEGWKYLKLMGKCDLTPKPEHLASMVDLLGRSGLLAEAFK 571 Query: 182 LVKQLPLNLPVYAWETLLSSCRVHENFELADIVAKKL 292 LV Q ++P YAW LLS+C +H N+EL+D++A K+ Sbjct: 572 LVNQFHSDIPTYAWGALLSACNMHGNYELSDLIADKI 608 >ref|XP_008810790.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like [Phoenix dactylifera] Length = 672 Score = 122 bits (306), Expect = 1e-25 Identities = 55/97 (56%), Positives = 71/97 (73%), Gaps = 1/97 (1%) Frame = +2 Query: 5 PDSVTFLGLLIACAHCGLVGQGWKYFNLM-EMWKLIPKPEHYAVMVDLLSRSGLVVEAYE 181 PD TFL LL+ACAH GLV +GW YF M E WKL+PKPEHY+ MVDLL R G + +AYE Sbjct: 491 PDHATFLSLLLACAHKGLVDEGWWYFKSMQEDWKLVPKPEHYSCMVDLLGRLGFISQAYE 550 Query: 182 LVKQLPLNLPVYAWETLLSSCRVHENFELADIVAKKL 292 ++P+++ AWETLLS+CRVH N E ++ AK++ Sbjct: 551 FANKMPVDIRTTAWETLLSACRVHGNLEFGELAAKRV 587 >ref|XP_009384595.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like [Musa acuminata subsp. malaccensis] Length = 664 Score = 120 bits (302), Expect = 3e-25 Identities = 56/97 (57%), Positives = 72/97 (74%), Gaps = 1/97 (1%) Frame = +2 Query: 5 PDSVTFLGLLIACAHCGLVGQGWKYFNLMEM-WKLIPKPEHYAVMVDLLSRSGLVVEAYE 181 PD TFL LL+AC+H GLV +G +YF+ M+ W IPKPEHY+ MVDLL RSGLV +A+E Sbjct: 483 PDHATFLSLLLACSHKGLVNEGCQYFDSMQKDWNFIPKPEHYSCMVDLLGRSGLVTQAHE 542 Query: 182 LVKQLPLNLPVYAWETLLSSCRVHENFELADIVAKKL 292 K++P+ L AWETLLSSCR + N EL ++ AKK+ Sbjct: 543 FTKKIPVQLQTTAWETLLSSCRYYGNLELGEVAAKKV 579 >gb|KNA15388.1| hypothetical protein SOVF_098680 [Spinacia oleracea] Length = 631 Score = 119 bits (298), Expect = 9e-25 Identities = 57/98 (58%), Positives = 73/98 (74%), Gaps = 1/98 (1%) Frame = +2 Query: 2 EPDSVTFLGLLIACAHCGLVGQGWKYFNLMEM-WKLIPKPEHYAVMVDLLSRSGLVVEAY 178 +P+ VTFL LL ACAH GL +G KYF M+ W + P PEHYA MVDL RSG++ EAY Sbjct: 446 KPNHVTFLALLTACAHWGLAKEGQKYFKSMKNEWNITPHPEHYACMVDLFGRSGMLYEAY 505 Query: 179 ELVKQLPLNLPVYAWETLLSSCRVHENFELADIVAKKL 292 ELVKQLPLN YAWETLL+ C++H +F L +IV++++ Sbjct: 506 ELVKQLPLNDTSYAWETLLNYCKLHGDFVLGEIVSQRI 543 >ref|XP_010921784.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like [Elaeis guineensis] Length = 565 Score = 117 bits (292), Expect = 4e-24 Identities = 52/97 (53%), Positives = 70/97 (72%), Gaps = 1/97 (1%) Frame = +2 Query: 5 PDSVTFLGLLIACAHCGLVGQG-WKYFNLMEMWKLIPKPEHYAVMVDLLSRSGLVVEAYE 181 PD TFL LL+ACAH GLV +G W + ++ E W L+PKPEHY+ MVDLL RSG + +AYE Sbjct: 384 PDHATFLSLLLACAHKGLVDEGCWYFKSMQEDWSLVPKPEHYSCMVDLLGRSGFISQAYE 443 Query: 182 LVKQLPLNLPVYAWETLLSSCRVHENFELADIVAKKL 292 ++P++ AWETLLS+CRVH N E ++ AK++ Sbjct: 444 FANKIPVDSQTTAWETLLSACRVHGNLEFGELAAKRV 480 >ref|XP_009597485.1| PREDICTED: pentatricopeptide repeat-containing protein At5g50990 isoform X2 [Nicotiana tomentosiformis] Length = 471 Score = 117 bits (292), Expect = 4e-24 Identities = 52/100 (52%), Positives = 75/100 (75%), Gaps = 1/100 (1%) Frame = +2 Query: 5 PDSVTFLGLLIACAHCGLVGQGWKYFNLMEMWKLI-PKPEHYAVMVDLLSRSGLVVEAYE 181 PDS+TF+GLL AC+HCGLV +G KYF+LM+ LI P+ EHY MVDLL R+GL+ EAY Sbjct: 201 PDSITFIGLLTACSHCGLVEEGRKYFDLMKSMYLIQPQLEHYGAMVDLLGRAGLLDEAYT 260 Query: 182 LVKQLPLNLPVYAWETLLSSCRVHENFELADIVAKKLSSL 301 ++K++P+ + W T LS+CR+H+N E+ ++ + K+S L Sbjct: 261 MIKEMPIEPDIIIWRTFLSACRIHKNSEMGELASTKISHL 300 >ref|XP_009597484.1| PREDICTED: pentatricopeptide repeat-containing protein At5g50990 isoform X1 [Nicotiana tomentosiformis] Length = 555 Score = 117 bits (292), Expect = 4e-24 Identities = 52/100 (52%), Positives = 75/100 (75%), Gaps = 1/100 (1%) Frame = +2 Query: 5 PDSVTFLGLLIACAHCGLVGQGWKYFNLMEMWKLI-PKPEHYAVMVDLLSRSGLVVEAYE 181 PDS+TF+GLL AC+HCGLV +G KYF+LM+ LI P+ EHY MVDLL R+GL+ EAY Sbjct: 285 PDSITFIGLLTACSHCGLVEEGRKYFDLMKSMYLIQPQLEHYGAMVDLLGRAGLLDEAYT 344 Query: 182 LVKQLPLNLPVYAWETLLSSCRVHENFELADIVAKKLSSL 301 ++K++P+ + W T LS+CR+H+N E+ ++ + K+S L Sbjct: 345 MIKEMPIEPDIIIWRTFLSACRIHKNSEMGELASTKISHL 384 >ref|XP_009793646.1| PREDICTED: pentatricopeptide repeat-containing protein At5g50990 [Nicotiana sylvestris] gi|698494977|ref|XP_009793647.1| PREDICTED: pentatricopeptide repeat-containing protein At5g50990 [Nicotiana sylvestris] gi|698494980|ref|XP_009793648.1| PREDICTED: pentatricopeptide repeat-containing protein At5g50990 [Nicotiana sylvestris] Length = 549 Score = 116 bits (290), Expect = 8e-24 Identities = 51/100 (51%), Positives = 75/100 (75%), Gaps = 1/100 (1%) Frame = +2 Query: 5 PDSVTFLGLLIACAHCGLVGQGWKYFNLME-MWKLIPKPEHYAVMVDLLSRSGLVVEAYE 181 PDS+TF+GLL AC+HCGLV +GWKYF+LM+ M+ + P+ EHY MVDLL R+GL+ EAY Sbjct: 279 PDSITFIGLLTACSHCGLVEEGWKYFDLMKSMYLMEPQLEHYGAMVDLLGRAGLLDEAYT 338 Query: 182 LVKQLPLNLPVYAWETLLSSCRVHENFELADIVAKKLSSL 301 +VK++P+ W T LS+ R+H++ E+ ++ + K+S L Sbjct: 339 MVKEMPIQPDAVIWRTFLSASRIHKSSEMGEVASTKISHL 378