BLASTX nr result
ID: Gardenia21_contig00026418
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00026418 (426 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP13665.1| unnamed protein product [Coffea canephora] 57 4e-06 >emb|CDP13665.1| unnamed protein product [Coffea canephora] Length = 358 Score = 57.4 bits (137), Expect = 4e-06 Identities = 28/41 (68%), Positives = 32/41 (78%) Frame = -3 Query: 424 LRLGYKRYMAEDSGRSLSDYISILQELHNLSILKSEWLWNK 302 LRLGYK YM DSGR LS YIS+LQEL + SIL+S WL N+ Sbjct: 309 LRLGYKSYMTGDSGRCLSGYISMLQELQHQSILRSTWLRNR 349