BLASTX nr result
ID: Gardenia21_contig00026354
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00026354 (209 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002489092.1| hypothetical protein SORBIDRAFT_0088s002240,... 70 6e-10 >ref|XP_002489092.1| hypothetical protein SORBIDRAFT_0088s002240, partial [Sorghum bicolor] gi|241947412|gb|EES20557.1| hypothetical protein SORBIDRAFT_0088s002240, partial [Sorghum bicolor] Length = 58 Score = 70.1 bits (170), Expect = 6e-10 Identities = 34/45 (75%), Positives = 36/45 (80%), Gaps = 3/45 (6%) Frame = +1 Query: 4 LLTEPYVDVTAHTAPSQQTVSLPLQGMEVWMNRHQI---EEFFFF 129 LLTEPYVDVTAHTAPSQQ VS PL+ MEVW+NRHQ FFFF Sbjct: 10 LLTEPYVDVTAHTAPSQQAVSFPLEVMEVWINRHQTLVDRRFFFF 54