BLASTX nr result
ID: Gardenia21_contig00026244
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00026244 (286 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDO99246.1| unnamed protein product [Coffea canephora] 111 2e-22 ref|XP_007160443.1| hypothetical protein PHAVU_002G3226001g [Pha... 62 2e-07 ref|XP_010326767.1| PREDICTED: putative pentatricopeptide repeat... 61 4e-07 ref|XP_002528839.1| pentatricopeptide repeat-containing protein,... 61 4e-07 ref|XP_014506801.1| PREDICTED: putative pentatricopeptide repeat... 60 5e-07 gb|KOM26873.1| hypothetical protein LR48_Vigan325s004500 [Vigna ... 60 5e-07 ref|XP_010113218.1| hypothetical protein L484_000327 [Morus nota... 60 5e-07 ref|XP_010104766.1| hypothetical protein L484_021456 [Morus nota... 60 5e-07 ref|XP_010653129.1| PREDICTED: putative pentatricopeptide repeat... 60 5e-07 ref|XP_009771285.1| PREDICTED: putative pentatricopeptide repeat... 60 5e-07 ref|XP_009771284.1| PREDICTED: putative pentatricopeptide repeat... 60 5e-07 emb|CBI31172.3| unnamed protein product [Vitis vinifera] 60 5e-07 ref|XP_006354473.1| PREDICTED: putative pentatricopeptide repeat... 60 5e-07 emb|CAN70248.1| hypothetical protein VITISV_032008 [Vitis vinifera] 60 5e-07 ref|XP_011073539.1| PREDICTED: putative pentatricopeptide repeat... 60 6e-07 ref|XP_010069117.1| PREDICTED: putative pentatricopeptide repeat... 60 6e-07 gb|KCW57362.1| hypothetical protein EUGRSUZ_H00147 [Eucalyptus g... 60 6e-07 gb|KHN21622.1| Putative pentatricopeptide repeat-containing prot... 60 8e-07 ref|XP_009598079.1| PREDICTED: putative pentatricopeptide repeat... 60 8e-07 ref|XP_003524358.1| PREDICTED: putative pentatricopeptide repeat... 60 8e-07 >emb|CDO99246.1| unnamed protein product [Coffea canephora] Length = 715 Score = 111 bits (278), Expect = 2e-22 Identities = 64/94 (68%), Positives = 64/94 (68%) Frame = +3 Query: 3 DEFPERKKHGGSFRNTWMGNNHPDKVNVHLISGGVGLKDYMTAKPIEMEALGMGTVRKVF 182 DEFPERKK VGLKD MT KPIEMEALGM TVRKVF Sbjct: 166 DEFPERKKQV------------------------VGLKD-MTEKPIEMEALGMDTVRKVF 200 Query: 183 QTMPIRDVVSWNTIIQGNVHGGCYKEALGMLREM 284 QTMPIRDVVSWNTIIQGNVHGG YKEALGMLREM Sbjct: 201 QTMPIRDVVSWNTIIQGNVHGGRYKEALGMLREM 234 >ref|XP_007160443.1| hypothetical protein PHAVU_002G3226001g [Phaseolus vulgaris] gi|561033858|gb|ESW32437.1| hypothetical protein PHAVU_002G3226001g [Phaseolus vulgaris] Length = 683 Score = 62.0 bits (149), Expect = 2e-07 Identities = 28/45 (62%), Positives = 34/45 (75%) Frame = +3 Query: 150 ALGMGTVRKVFQTMPIRDVVSWNTIIQGNVHGGCYKEALGMLREM 284 A+ + VRKVF MP+RDVVSWNT+I GN G Y+EAL M+REM Sbjct: 155 AVKIDCVRKVFDRMPVRDVVSWNTVIAGNAQNGMYEEALDMVREM 199 >ref|XP_010326767.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g23330 [Solanum lycopersicum] Length = 734 Score = 60.8 bits (146), Expect = 4e-07 Identities = 28/45 (62%), Positives = 34/45 (75%) Frame = +3 Query: 150 ALGMGTVRKVFQTMPIRDVVSWNTIIQGNVHGGCYKEALGMLREM 284 A G+ +V K+FQ MP +DVVSWNT+I GNV G Y+EAL LREM Sbjct: 209 ATGLDSVSKIFQMMPDKDVVSWNTVIGGNVQSGLYEEALERLREM 253 >ref|XP_002528839.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223531751|gb|EEF33573.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 393 Score = 60.8 bits (146), Expect = 4e-07 Identities = 34/75 (45%), Positives = 49/75 (65%), Gaps = 2/75 (2%) Frame = +3 Query: 66 HPD-KVNVHL-ISGGVGLKDYMTAKPIEMEALGMGTVRKVFQTMPIRDVVSWNTIIQGNV 239 HPD KV+ + ++G + + Y + I + +VRKVF+ MP RD+VSWNT+I GN Sbjct: 105 HPDRKVSPQISVNGYITDQSYKASHNI-CRTSDVDSVRKVFEMMPKRDLVSWNTVIAGNA 163 Query: 240 HGGCYKEALGMLREM 284 H G ++EAL M+REM Sbjct: 164 HNGMHEEALVMVREM 178 >ref|XP_014506801.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g23330 [Vigna radiata var. radiata] Length = 685 Score = 60.5 bits (145), Expect = 5e-07 Identities = 26/40 (65%), Positives = 32/40 (80%) Frame = +3 Query: 165 TVRKVFQTMPIRDVVSWNTIIQGNVHGGCYKEALGMLREM 284 +VRKVF MP+RDVVSWNT+I GN G Y+EAL ++REM Sbjct: 164 SVRKVFDRMPVRDVVSWNTVIAGNAQNGMYEEALDLVREM 203 >gb|KOM26873.1| hypothetical protein LR48_Vigan325s004500 [Vigna angularis] Length = 685 Score = 60.5 bits (145), Expect = 5e-07 Identities = 26/40 (65%), Positives = 32/40 (80%) Frame = +3 Query: 165 TVRKVFQTMPIRDVVSWNTIIQGNVHGGCYKEALGMLREM 284 +VRKVF MP+RDVVSWNT+I GN G Y+EAL ++REM Sbjct: 164 SVRKVFDRMPVRDVVSWNTVIAGNAQNGMYEEALDLVREM 203 >ref|XP_010113218.1| hypothetical protein L484_000327 [Morus notabilis] gi|587990314|gb|EXC74564.1| hypothetical protein L484_000327 [Morus notabilis] Length = 590 Score = 60.5 bits (145), Expect = 5e-07 Identities = 26/42 (61%), Positives = 32/42 (76%) Frame = +3 Query: 159 MGTVRKVFQTMPIRDVVSWNTIIQGNVHGGCYKEALGMLREM 284 + +VRKVF MP +D+VSWNT+I GN G Y+EAL MLREM Sbjct: 67 INSVRKVFDMMPYKDIVSWNTVIAGNAQNGMYEEALSMLREM 108 >ref|XP_010104766.1| hypothetical protein L484_021456 [Morus notabilis] gi|587914027|gb|EXC01816.1| hypothetical protein L484_021456 [Morus notabilis] Length = 709 Score = 60.5 bits (145), Expect = 5e-07 Identities = 26/42 (61%), Positives = 32/42 (76%) Frame = +3 Query: 159 MGTVRKVFQTMPIRDVVSWNTIIQGNVHGGCYKEALGMLREM 284 + +VRKVF MP +D+VSWNT+I GN G Y+EAL MLREM Sbjct: 186 INSVRKVFDMMPYKDIVSWNTVIAGNAQNGMYEEALSMLREM 227 >ref|XP_010653129.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g23330 [Vitis vinifera] gi|731398080|ref|XP_010653130.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g23330 [Vitis vinifera] gi|731398082|ref|XP_010653131.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g23330 [Vitis vinifera] gi|731398084|ref|XP_010653132.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g23330 [Vitis vinifera] gi|731398086|ref|XP_010653133.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g23330 [Vitis vinifera] gi|731398088|ref|XP_010653134.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g23330 [Vitis vinifera] gi|731398090|ref|XP_010653135.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g23330 [Vitis vinifera] Length = 765 Score = 60.5 bits (145), Expect = 5e-07 Identities = 26/48 (54%), Positives = 37/48 (77%) Frame = +3 Query: 141 EMEALGMGTVRKVFQTMPIRDVVSWNTIIQGNVHGGCYKEALGMLREM 284 E E+ +G++RKVF+ MP RD+VSWNT+I GN G +++AL M+REM Sbjct: 236 EKESYYLGSLRKVFEMMPKRDIVSWNTVISGNAQNGMHEDALMMVREM 283 >ref|XP_009771285.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g23330 isoform X2 [Nicotiana sylvestris] Length = 640 Score = 60.5 bits (145), Expect = 5e-07 Identities = 29/56 (51%), Positives = 40/56 (71%) Frame = +3 Query: 117 DYMTAKPIEMEALGMGTVRKVFQTMPIRDVVSWNTIIQGNVHGGCYKEALGMLREM 284 D ++ + +E + + +V K+FQ MP +DVVSWNT+I GNV G Y+EAL MLREM Sbjct: 105 DTLSGRRVE-KGTRLDSVSKIFQMMPNKDVVSWNTVIGGNVQSGLYEEALDMLREM 159 >ref|XP_009771284.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g23330 isoform X1 [Nicotiana sylvestris] Length = 737 Score = 60.5 bits (145), Expect = 5e-07 Identities = 29/56 (51%), Positives = 40/56 (71%) Frame = +3 Query: 117 DYMTAKPIEMEALGMGTVRKVFQTMPIRDVVSWNTIIQGNVHGGCYKEALGMLREM 284 D ++ + +E + + +V K+FQ MP +DVVSWNT+I GNV G Y+EAL MLREM Sbjct: 202 DTLSGRRVE-KGTRLDSVSKIFQMMPNKDVVSWNTVIGGNVQSGLYEEALDMLREM 256 >emb|CBI31172.3| unnamed protein product [Vitis vinifera] Length = 644 Score = 60.5 bits (145), Expect = 5e-07 Identities = 26/48 (54%), Positives = 37/48 (77%) Frame = +3 Query: 141 EMEALGMGTVRKVFQTMPIRDVVSWNTIIQGNVHGGCYKEALGMLREM 284 E E+ +G++RKVF+ MP RD+VSWNT+I GN G +++AL M+REM Sbjct: 180 EKESYYLGSLRKVFEMMPKRDIVSWNTVISGNAQNGMHEDALMMVREM 227 >ref|XP_006354473.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g23330-like [Solanum tuberosum] Length = 738 Score = 60.5 bits (145), Expect = 5e-07 Identities = 28/45 (62%), Positives = 34/45 (75%) Frame = +3 Query: 150 ALGMGTVRKVFQTMPIRDVVSWNTIIQGNVHGGCYKEALGMLREM 284 A G+ +V K+FQ MP +DVVSWNT+I GNV G Y+EAL LREM Sbjct: 213 AKGLDSVSKIFQMMPDKDVVSWNTVIGGNVQSGLYEEALERLREM 257 >emb|CAN70248.1| hypothetical protein VITISV_032008 [Vitis vinifera] Length = 679 Score = 60.5 bits (145), Expect = 5e-07 Identities = 26/48 (54%), Positives = 37/48 (77%) Frame = +3 Query: 141 EMEALGMGTVRKVFQTMPIRDVVSWNTIIQGNVHGGCYKEALGMLREM 284 E E+ +G++RKVF+ MP RD+VSWNT+I GN G +++AL M+REM Sbjct: 140 EKESYYLGSLRKVFEMMPKRDIVSWNTVISGNAQNGMHEDALMMVREM 187 >ref|XP_011073539.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g23330 [Sesamum indicum] gi|747054646|ref|XP_011073540.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g23330 [Sesamum indicum] gi|747054648|ref|XP_011073541.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g23330 [Sesamum indicum] gi|747054650|ref|XP_011073543.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g23330 [Sesamum indicum] gi|747054652|ref|XP_011073544.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g23330 [Sesamum indicum] gi|747054654|ref|XP_011073545.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g23330 [Sesamum indicum] gi|747054656|ref|XP_011073546.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g23330 [Sesamum indicum] gi|747054658|ref|XP_011073547.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g23330 [Sesamum indicum] gi|747054660|ref|XP_011073548.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g23330 [Sesamum indicum] gi|747054662|ref|XP_011073549.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g23330 [Sesamum indicum] gi|747054664|ref|XP_011073550.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g23330 [Sesamum indicum] gi|747054666|ref|XP_011073551.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g23330 [Sesamum indicum] gi|747054668|ref|XP_011073552.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g23330 [Sesamum indicum] gi|747054670|ref|XP_011073553.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g23330 [Sesamum indicum] Length = 812 Score = 60.1 bits (144), Expect = 6e-07 Identities = 29/53 (54%), Positives = 39/53 (73%) Frame = +3 Query: 126 TAKPIEMEALGMGTVRKVFQTMPIRDVVSWNTIIQGNVHGGCYKEALGMLREM 284 ++K + A +VRKVF+TMP+RDVVSWNT+I G+V G ++EAL LREM Sbjct: 278 SSKEKKKGAFPADSVRKVFETMPVRDVVSWNTVIGGHVENGMHEEALLALREM 330 >ref|XP_010069117.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g23330 [Eucalyptus grandis] Length = 742 Score = 60.1 bits (144), Expect = 6e-07 Identities = 28/40 (70%), Positives = 31/40 (77%) Frame = +3 Query: 165 TVRKVFQTMPIRDVVSWNTIIQGNVHGGCYKEALGMLREM 284 +VRKVF MP RDVVSWNT+I GNV G Y EAL M+REM Sbjct: 221 SVRKVFDMMPQRDVVSWNTVIAGNVQSGMYGEALAMVREM 260 >gb|KCW57362.1| hypothetical protein EUGRSUZ_H00147 [Eucalyptus grandis] Length = 686 Score = 60.1 bits (144), Expect = 6e-07 Identities = 28/40 (70%), Positives = 31/40 (77%) Frame = +3 Query: 165 TVRKVFQTMPIRDVVSWNTIIQGNVHGGCYKEALGMLREM 284 +VRKVF MP RDVVSWNT+I GNV G Y EAL M+REM Sbjct: 165 SVRKVFDMMPQRDVVSWNTVIAGNVQSGMYGEALAMVREM 204 >gb|KHN21622.1| Putative pentatricopeptide repeat-containing protein [Glycine soja] Length = 640 Score = 59.7 bits (143), Expect = 8e-07 Identities = 25/40 (62%), Positives = 32/40 (80%) Frame = +3 Query: 165 TVRKVFQTMPIRDVVSWNTIIQGNVHGGCYKEALGMLREM 284 +VRK+F MP+RDVVSWNT+I GN G Y+EAL M++EM Sbjct: 151 SVRKLFDRMPVRDVVSWNTVIAGNAQNGMYEEALNMVKEM 190 >ref|XP_009598079.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g23330 [Nicotiana tomentosiformis] Length = 737 Score = 59.7 bits (143), Expect = 8e-07 Identities = 27/42 (64%), Positives = 32/42 (76%) Frame = +3 Query: 159 MGTVRKVFQTMPIRDVVSWNTIIQGNVHGGCYKEALGMLREM 284 + V K+FQ MP +DVVSWNT+I GNV G Y+EAL MLREM Sbjct: 215 LDNVSKIFQMMPNKDVVSWNTVIGGNVQSGLYEEALDMLREM 256 >ref|XP_003524358.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g23330-like isoform X1 [Glycine max] gi|571456574|ref|XP_006580426.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g23330-like isoform X2 [Glycine max] gi|947112111|gb|KRH60437.1| hypothetical protein GLYMA_05G240300 [Glycine max] Length = 674 Score = 59.7 bits (143), Expect = 8e-07 Identities = 25/40 (62%), Positives = 32/40 (80%) Frame = +3 Query: 165 TVRKVFQTMPIRDVVSWNTIIQGNVHGGCYKEALGMLREM 284 +VRK+F MP+RDVVSWNT+I GN G Y+EAL M++EM Sbjct: 151 SVRKLFDRMPVRDVVSWNTVIAGNAQNGMYEEALNMVKEM 190