BLASTX nr result
ID: Gardenia21_contig00026150
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00026150 (260 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP20527.1| unnamed protein product [Coffea canephora] 138 1e-30 >emb|CDP20527.1| unnamed protein product [Coffea canephora] Length = 947 Score = 138 bits (348), Expect = 1e-30 Identities = 69/82 (84%), Positives = 75/82 (91%) Frame = -1 Query: 260 EASPSRGHETRRKLSHQVHGLPIRIHQVTMSSELQAPLGPGPDSRATGTPKRKRIRKSGS 81 + SPSRGHE +RKLS Q+HGLPIRI+QVTMSSELQAPLGPG +S AT PK+KRIRKSGS Sbjct: 415 KTSPSRGHEMKRKLSPQLHGLPIRINQVTMSSELQAPLGPGAESPATAIPKQKRIRKSGS 474 Query: 80 GSYKETARRILDPEPLISTTSV 15 GSYKETARRILDPEPLISTTSV Sbjct: 475 GSYKETARRILDPEPLISTTSV 496