BLASTX nr result
ID: Gardenia21_contig00026105
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00026105 (351 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP11246.1| unnamed protein product [Coffea canephora] 42 9e-08 >emb|CDP11246.1| unnamed protein product [Coffea canephora] Length = 669 Score = 42.4 bits (98), Expect(2) = 9e-08 Identities = 21/41 (51%), Positives = 29/41 (70%) Frame = -1 Query: 126 KCWLTKFKIMPFLVKKPLSNEDLWSIEKDENFVQQIERIKK 4 K L +FK +PFLVKKPL+ E+ ++EKDEN Q + +KK Sbjct: 257 KGMLNEFKKVPFLVKKPLAFENKQTVEKDENVEVQKDEMKK 297 Score = 40.4 bits (93), Expect(2) = 9e-08 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = -3 Query: 226 KSNRVSINLMNNLHLQDLEIPGVTVLTRWDK 134 KSN ++N MNN LQD ++PGVTVLTR DK Sbjct: 223 KSNLEAVNPMNNPILQDPDMPGVTVLTRGDK 253