BLASTX nr result
ID: Gardenia21_contig00026007
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00026007 (401 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP19896.1| unnamed protein product [Coffea canephora] 60 6e-07 >emb|CDP19896.1| unnamed protein product [Coffea canephora] Length = 872 Score = 60.1 bits (144), Expect = 6e-07 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -3 Query: 99 MPLLRPSAGDVAGFKVLCFLGIMYGLMSLLVFS 1 MPL RPSA DVAGFKVLC LGIMYGLMSLLV+S Sbjct: 1 MPLFRPSARDVAGFKVLCCLGIMYGLMSLLVYS 33